Result : EXP02301
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02301 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2060458 |
| Right | 2060631 |
| Strand | - |
| Nucleotide Sequence | ATGAAATTCAAAGTAAATGAGAATGAAACAATTGCTGATTGTTTGTCACGAATGAAAATGCAAGGGTATATGCCGGTAAAACGTATTGAAAAACCCGTGTTTCAAGAGCAAAAAGATGGCACGGTTGAAGTATCACATCAAGAAATCGTTTTTGTAGGTAAGAAAATCCAATAA |
| Sequence | MKFKVNENETIADCLSRMKMQGYMPVKRIEKPVFQEQKDGTVEVSHQEIVFVGKKIQ |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam14044. Profile Description: NETI protein. This family includes the B. subtilis YebG protein, which is functionally uncharacterized. This is not a homolog of E. coli YebG, which belongs to pfam07130. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 66 amino acids in length and contain a conserved NETI motif. |
| Pubmed ID | 34061833 |
| Domain | CDD:404854 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 58
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2004154 | 2004327 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2005369 | 2005542 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 937829 | 938005 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 4 | 1511815 | 1512000 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 5 | 492589 | 492765 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 1921834 | 1922010 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 7 | 834844 | 835032 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 8 | 5799 | 5981 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 9 | 1028701 | 1028880 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 10 | 1218607 | 1218786 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 11 | 396158 | 396346 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 12 | 1703330 | 1703512 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 13 | 811403 | 811597 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 14 | 1133894 | 1134070 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 15 | 1566905 | 1567075 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 16 | 909600 | 909782 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 17 | 969684 | 969863 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 18 | 2486659 | 2486838 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 19 | 1459065 | 1459241 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 20 | 1960567 | 1960743 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 21 | 1384826 | 1384999 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 22 | 776644 | 776820 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 23 | 1564997 | 1565173 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 24 | 154534 | 154722 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 25 | 968821 | 969006 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 26 | 1006166 | 1006351 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 27 | 941464 | 941652 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 28 | 1735344 | 1735532 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 29 | 690349 | 690525 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 30 | 2408169 | 2408345 | - | NZ_CP027770.1 | Staphylococcus felis |
| 31 | 1770307 | 1770492 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 32 | 1897663 | 1897839 | - | NZ_CP047361.1 | Macrococcus canis |
| 33 | 1954044 | 1954217 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 34 | 3321541 | 3321720 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 35 | 357721 | 357903 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 36 | 2158935 | 2159135 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 37 | 2005132 | 2005293 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 38 | 1824952 | 1825146 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 39 | 348090 | 348281 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 40 | 2193033 | 2193233 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 41 | 2065657 | 2065857 | + | NZ_CP040336.1 | Bacillus luti |
| 42 | 998844 | 999038 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 43 | 1304333 | 1304482 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 44 | 3183579 | 3183779 | - | NC_011725.1 | Bacillus cereus B4264 |
| 45 | 235125 | 235328 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 46 | 3231310 | 3231510 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 47 | 249511 | 249711 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 48 | 3083307 | 3083507 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 49 | 273887 | 274090 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 50 | 667439 | 667612 | + | NZ_CP053989.1 | Niallia circulans |
| 51 | 3075954 | 3076154 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 52 | 3842039 | 3842239 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 53 | 676175 | 676372 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 54 | 2803799 | 2803996 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 55 | 2417778 | 2417948 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 56 | 24179 | 24355 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 57 | 2287142 | 2287333 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 58 | 669845 | 669988 | + | NZ_CP013659.2 | Planococcus rifietoensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00206.22 | 0.88 | 51 | 366 | same-strand | Lyase |
| 2 | PF10397.11 | 0.88 | 51 | 366 | same-strand | Adenylosuccinate lyase C-terminus |
| 3 | PF18955.2 | 0.79 | 46 | -10.0 | same-strand | Domain of unknown function (DUF5698) |
| 4 | PF10035.11 | 0.79 | 46 | -10.0 | same-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
| 5 | PF02540.19 | 0.6 | 35 | 661 | same-strand | NAD synthase |
| 6 | PF17767.3 | 0.6 | 35 | 1476 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain |
| 7 | PF17956.3 | 0.6 | 35 | 1476 | same-strand | Nicotinate phosphoribosyltransferase C-terminal domain |
| 8 | PF04095.18 | 0.6 | 35 | 1476 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) family |
++ More..