Result : B4RE94
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | CP000747.1 |
| Organism | Phenylobacterium zucineum (strain HLK1) |
| Left | 430268 |
| Right | 430525 |
| Strand | + |
| Nucleotide Sequence | ATGAACCTCTACGAGAGCTGCGTCAGAGGGGCCTTGCGGGCCTACAAGCTGACGCTTTCGCCTTTGATCGGGCGCCAATGCCGGTTCTTTCCGACCTGTTCGGAATATGCGGCCGAGGCCCTGATCGGGCACGGACCGGTGCGCGGATCCTGGCTGACCGTGCGCCGCCTGTGCCGATGCCATCCCTGGGGGCCGTCGGGCTGGGACCCGCCGCCGCCCCCGCGCCGCAAAGGCGCGAAATGGACGTGTGAGACATGA |
| Sequence | MNLYESCVRGALRAYKLTLSPLIGRQCRFFPTCSEYAAEALIGHGPVRGSWLTVRRLCRCHPWGPSGWDPPPPPRRKGAKWTCET |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 18700039 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | B4RE94 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 152
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 430268 | 430525 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 2 | 1482097 | 1482333 | + | NZ_CP022048.2 | Brevundimonas vesicularis |
| 3 | 482494 | 482748 | + | NZ_CP013002.1 | Caulobacter henricii |
| 4 | 192802 | 193050 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 5 | 566933 | 567187 | + | NZ_CP027850.1 | Caulobacter segnis |
| 6 | 512080 | 512334 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 7 | 4027944 | 4028186 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 8 | 5108874 | 5109128 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 9 | 1004346 | 1004600 | - | NZ_CP026100.1 | Caulobacter flavus |
| 10 | 609383 | 609616 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 11 | 1898051 | 1898260 | - | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 12 | 576346 | 576573 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 13 | 31338 | 31607 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 14 | 395474 | 395689 | + | NZ_CP035510.1 | Haematobacter massiliensis |
| 15 | 4690706 | 4690942 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 16 | 36376 | 36612 | - | NZ_CP024608.1 | Massilia violaceinigra |
| 17 | 3452918 | 3453181 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 18 | 2639281 | 2639535 | + | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 19 | 3778308 | 3778514 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 20 | 137500 | 137727 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 21 | 6372224 | 6372430 | - | NZ_CP048832.1 | Janthinobacterium lividum |
| 22 | 4170837 | 4171064 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 23 | 3657176 | 3657385 | - | NZ_CP028339.1 | Thauera aromatica K172 |
| 24 | 3895217 | 3895423 | - | NZ_CP041185.1 | Janthinobacterium tructae |
| 25 | 6273005 | 6273211 | - | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 26 | 3432655 | 3432915 | - | NZ_CP046904.1 | Massilia flava |
| 27 | 14717 | 14986 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 28 | 3734651 | 3734860 | - | NZ_CP018839.1 | Thauera chlorobenzoica |
| 29 | 2538664 | 2538939 | - | NZ_LR134302.1 | Achromobacter spanius |
| 30 | 2832566 | 2832793 | + | NZ_CP017561.1 | Paraburkholderia sprentiae WSM5005 |
| 31 | 2709818 | 2710030 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 32 | 679496 | 679723 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 33 | 3238599 | 3238838 | - | NZ_CP046913.1 | Paraburkholderia acidisoli |
| 34 | 1904787 | 1905017 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 35 | 233965 | 234237 | + | NZ_AP019700.1 | Stella humosa |
| 36 | 3503843 | 3504055 | - | NZ_CP013398.1 | Burkholderia seminalis |
| 37 | 3686695 | 3686907 | - | NZ_CP045235.1 | Burkholderia cepacia |
| 38 | 3692828 | 3693040 | - | NC_007510.1 | Burkholderia lata |
| 39 | 3058832 | 3059050 | - | NC_014207.1 | Methylotenera versatilis 301 |
| 40 | 5834394 | 5834666 | - | NZ_CP016172.1 | Bordetella flabilis |
| 41 | 3950622 | 3950837 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 42 | 3108244 | 3108468 | - | NZ_CP022196.1 | Celeribacter ethanolicus |
| 43 | 1354661 | 1354879 | + | NZ_CP030918.1 | Paracoccus suum |
| 44 | 652581 | 652808 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 45 | 2172092 | 2172322 | - | NZ_CP031467.1 | Paraburkholderia caffeinilytica |
| 46 | 132574 | 132795 | - | NZ_CP009832.1 | Burkholderia multivorans ATCC BAA-247 |
| 47 | 647793 | 648005 | - | NC_018518.1 | Bordetella pertussis 18323 |
| 48 | 4057082 | 4057294 | + | NZ_AP019378.1 | Bordetella parapertussis |
| 49 | 5198486 | 5198698 | - | NZ_LR134326.1 | Bordetella bronchiseptica |
| 50 | 3153127 | 3153336 | + | NZ_CP014646.1 | Thauera humireducens |
| 51 | 1692961 | 1693173 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 52 | 3735761 | 3735982 | - | NZ_CP020737.1 | Paraburkholderia acidophila |
| 53 | 3712412 | 3712696 | + | NC_010645.1 | Bordetella avium 197N |
| 54 | 4998341 | 4998634 | - | NZ_CP053986.1 | Achromobacter denitrificans |
| 55 | 4488924 | 4489193 | - | NZ_CP016440.1 | Bordetella pseudohinzii |
| 56 | 1063541 | 1063807 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 57 | 4030230 | 4030436 | - | NZ_CP024934.1 | Paraburkholderia graminis |
| 58 | 1283670 | 1283879 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 59 | 4595189 | 4595410 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 60 | 3810627 | 3810836 | + | NZ_CP013119.1 | Alcaligenes faecalis |
| 61 | 2753891 | 2754112 | - | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 62 | 3933738 | 3933959 | - | NZ_CP013414.1 | Burkholderia ubonensis |
| 63 | 2552384 | 2552620 | - | NZ_CP042218.1 | Luteimonas granuli |
| 64 | 1854236 | 1854448 | - | NZ_CP059467.1 | Aromatoleum bremense |
| 65 | 2879539 | 2879769 | - | NZ_CP007035.1 | Niabella soli DSM 19437 |
| 66 | 28744 | 28974 | - | NZ_CP009238.1 | Basilea psittacipulmonis DSM 24701 |
| 67 | 329691 | 329948 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 68 | 6427557 | 6427829 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 69 | 6500568 | 6500804 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| 70 | 3905 | 4162 | - | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 71 | 5031352 | 5031600 | - | NZ_CP028897.1 | Dongshaea marina |
| 72 | 292173 | 292391 | + | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
| 73 | 2559512 | 2559724 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 74 | 5531029 | 5531292 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 75 | 338191 | 338448 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 76 | 704798 | 705037 | - | NZ_CP020612.1 | Paracoccus contaminans |
| 77 | 301088 | 301348 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 78 | 3001976 | 3002200 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 79 | 4528583 | 4528816 | - | NZ_CP012676.1 | Pseudomonas versuta |
| 80 | 968423 | 968665 | - | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 81 | 605878 | 606126 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 82 | 2395079 | 2395309 | - | NZ_LR699119.1 | Aquicella siphonis |
| 83 | 4070803 | 4071015 | - | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 84 | 2793678 | 2793911 | - | NZ_AP018150.1 | Mycoavidus cysteinexigens |
| 85 | 2946386 | 2946631 | + | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 86 | 3476260 | 3476496 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 87 | 6605086 | 6605328 | - | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 88 | 1863616 | 1863852 | - | NC_017856.1 | Methylophaga frappieri |
| 89 | 4197051 | 4197278 | - | NZ_CP041352.1 | Casimicrobium huifangae |
| 90 | 2993585 | 2993842 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 91 | 3989895 | 3990107 | + | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 92 | 1702558 | 1702767 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 93 | 7119221 | 7119463 | - | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 94 | 3438 | 3695 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 95 | 4830533 | 4830775 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
| 96 | 2870430 | 2870690 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 97 | 894506 | 894724 | - | NZ_CP055153.1 | Adhaeribacter radiodurans |
| 98 | 133209 | 133430 | - | NZ_CP045871.1 | Litoricola lipolytica |
| 99 | 2592886 | 2593137 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 100 | 5729779 | 5729997 | + | NZ_CP055156.1 | Adhaeribacter swui |
| 101 | 1033870 | 1034136 | - | NZ_CP014143.1 | Microbulbifer aggregans |
| 102 | 2555141 | 2555365 | - | NZ_CP043404.1 | Bacillus safensis |
| 103 | 3290840 | 3291097 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 104 | 3372570 | 3372779 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 105 | 1391432 | 1391647 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 106 | 2897914 | 2898171 | - | NZ_CP033078.1 | Vibrio zhugei |
| 107 | 2600398 | 2600655 | + | NZ_CP035688.1 | Vibrio metoecus |
| 108 | 3219 | 3476 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 109 | 147053 | 147310 | - | NZ_CP044069.1 | Vibrio vulnificus |
| 110 | 8211158 | 8211394 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 111 | 295738 | 295980 | - | NZ_CP033219.1 | Parasedimentitalea marina |
| 112 | 3135098 | 3135355 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 113 | 505450 | 505680 | + | NZ_CP060711.1 | Thermomonas brevis |
| 114 | 5028552 | 5028764 | - | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 115 | 3894005 | 3894211 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 116 | 4194540 | 4194758 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 117 | 5799230 | 5799502 | - | NZ_CP019236.1 | Rhodoferax koreense |
| 118 | 1554540 | 1554809 | - | NZ_CP033719.1 | Propionibacterium acidifaciens |
| 119 | 4206 | 4463 | - | NZ_AP014635.1 | Vibrio tritonius |
| 120 | 350458 | 350664 | - | NZ_CP037953.1 | Permianibacter aggregans |
| 121 | 5132978 | 5133202 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 122 | 2443704 | 2443916 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 123 | 2215922 | 2216140 | - | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 124 | 1758740 | 1758961 | - | NZ_CP007451.1 | Draconibacterium orientale |
| 125 | 1843330 | 1843587 | - | NZ_CP019959.1 | Vibrio owensii |
| 126 | 1559019 | 1559258 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 127 | 3257978 | 3258235 | - | NZ_CP030788.1 | Vibrio campbellii |
| 128 | 3112230 | 3112487 | + | NZ_CP018312.1 | Vibrio rotiferianus |
| 129 | 213348 | 213605 | - | NZ_CP009467.1 | Vibrio harveyi |
| 130 | 2242508 | 2242765 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 131 | 4054177 | 4054431 | + | NZ_CP042997.1 | Aquisphaera giovannonii |
| 132 | 2686119 | 2686346 | + | NZ_CP046603.1 | Lysobacter soli |
| 133 | 4132 | 4389 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 134 | 3813922 | 3814179 | - | NZ_CP046268.1 | Vibrio spartinae |
| 135 | 6889731 | 6889961 | + | NZ_CP019082.1 | Paludisphaera borealis |
| 136 | 2916417 | 2916674 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 137 | 423543 | 423800 | + | NC_013456.1 | Vibrio antiquarius |
| 138 | 3287456 | 3287713 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 139 | 1597318 | 1597560 | - | NZ_CP016312.1 | Thermus brockianus |
| 140 | 417522 | 417761 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 141 | 5423478 | 5423714 | - | NZ_CP012333.1 | Labilithrix luteola |
| 142 | 2366017 | 2366247 | - | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 143 | 2179892 | 2180119 | + | NZ_CP032317.1 | Hymenobacter oligotrophus |
| 144 | 3518103 | 3518324 | - | NZ_CP050954.1 | Hymenobacter sp. BT18 |
| 145 | 2369320 | 2369577 | - | NZ_CP038452.1 | Thermus caldilimi |
| 146 | 2842307 | 2842519 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 147 | 990232 | 990441 | - | NZ_CP009312.1 | Lawsonella clevelandensis |
| 148 | 3104151 | 3104372 | - | NC_017080.1 | Phycisphaera mikurensis NBRC 102666 |
| 149 | 1706837 | 1707085 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 150 | 265819 | 266049 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 151 | 3017613 | 3017831 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 152 | 2157314 | 2157535 | - | NC_013124.1 | Acidimicrobium ferrooxidans DSM 10331 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_018024.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02096.22 | 0.74 | 112 | 8.0 | same-strand | 60Kd inner membrane protein |
++ More..