Result : EXP02300
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02300 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1082358 |
| Right | 1082525 |
| Strand | - |
| Nucleotide Sequence | TTGAGACAAGTGCAATGCATTATCTGTGATGCAAAAGTATTTATAGATGAGCGCACAACTGAGTCTAAACGACTTAAAAACAATCCTATTCGAACATTTATGTGTGATGATTGTAAAAGTCGATTAGACACACCTAAACAACGTGCGCAACACTATCCGCTCGATTAA |
| Sequence | LRQVQCIICDAKVFIDERTTESKRLKNNPIRTFMCDDCKSRLDTPKQRAQHYPLD |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl23971. Profile Description: Uncharacterized protein conserved in bacteria (DUF2197). This domain, found in various hypothetical bacterial proteins, has no known function. |
| Pubmed ID | 34061833 |
| Domain | CDD:329205 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1025649 | 1025816 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1095834 | 1096001 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1074347 | 1074514 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1776006 | 1776161 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 5 | 781844 | 782035 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 6 | 206699 | 206893 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 7 | 1046868 | 1047041 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 8 | 1906189 | 1906377 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 9 | 83641 | 83814 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 10 | 1161519 | 1161707 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 11 | 2069574 | 2069747 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 12 | 1829922 | 1830095 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 13 | 911516 | 911689 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 14 | 728633 | 728818 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 15 | 1737663 | 1737836 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 16 | 1573834 | 1574007 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 17 | 1743651 | 1743818 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 18 | 1804157 | 1804354 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 19 | 1582757 | 1582927 | - | NZ_CP027770.1 | Staphylococcus felis |
| 20 | 1592298 | 1592435 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 21 | 1680272 | 1680427 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06335.14 | 0.95 | 20 | 3653.0 | same-strand | Protein of unknown function (DUF1054) |
| 2 | PF00459.27 | 0.95 | 20 | 2536.0 | opposite-strand | Inositol monophosphatase family |
| 3 | PF17259.4 | 1.0 | 21 | 2283 | same-strand | Family of unknown function (DUF5325) |
| 4 | PF00009.29 | 1.0 | 21 | 335 | opposite-strand | Elongation factor Tu GTP binding domain |
| 5 | PF00679.26 | 1.0 | 21 | 335 | opposite-strand | Elongation factor G C-terminus |
| 6 | PF03144.27 | 1.0 | 21 | 335 | opposite-strand | Elongation factor Tu domain 2 |
| 7 | PF01926.25 | 1.0 | 21 | 335 | opposite-strand | 50S ribosome-binding GTPase |
| 8 | PF07408.13 | 1.0 | 21 | 627 | opposite-strand | Protein of unknown function (DUF1507) |
| 9 | PF01098.21 | 1.0 | 21 | 1210 | opposite-strand | Cell cycle protein |
| 10 | PF02786.19 | 0.95 | 20 | 2868.0 | opposite-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 11 | PF02436.20 | 0.95 | 20 | 2868.0 | opposite-strand | Conserved carboxylase domain |
| 12 | PF00289.24 | 0.95 | 20 | 2868.0 | opposite-strand | Biotin carboxylase, N-terminal domain |
| 13 | PF02785.21 | 0.95 | 20 | 2868.0 | opposite-strand | Biotin carboxylase C-terminal domain |
| 14 | PF00682.21 | 0.95 | 20 | 2868.0 | opposite-strand | HMGL-like |
| 15 | PF00364.24 | 0.95 | 20 | 2868.0 | opposite-strand | Biotin-requiring enzyme |
| 16 | PF02222.24 | 0.95 | 20 | 2868.0 | opposite-strand | ATP-grasp domain |
| 17 | PF02655.16 | 0.95 | 20 | 2868.0 | opposite-strand | ATP-grasp domain |
| 18 | PF08443.13 | 0.67 | 14 | 2962.5 | opposite-strand | RimK-like ATP-grasp domain |
++ More..