Result : EXP02299
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02299 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1979699 |
| Right | 1979860 |
| Strand | - |
| Nucleotide Sequence | ATGAATGAACAGCAAACAATCGAACAGATAAAAGCGCGTTTAAATAAGTTTATTGAGGATATCGATCATGTAAATCCTGATGAAGTACGTGTTGAAGATATAGATGAATGGATTGGATTGTTAGATCAGCTTGAAGAAAAGGTTAAATTAGTATCTAAGTAA |
| Sequence | MNEQQTIEQIKARLNKFIEDIDHVNPDEVRVEDIDEWIGLLDQLEEKVKLVSK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1966961 | 1967122 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 2 | 1922968 | 1923129 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 3 | 1063032 | 1063193 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 4 | 970471 | 970632 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 5 | 458164 | 458325 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 1184912 | 1185073 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 7 | 1004113 | 1004274 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 8 | 1884146 | 1884307 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 9 | 975187 | 975363 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 10 | 1736287 | 1736448 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 11 | 1530249 | 1530410 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 12 | 1040304 | 1040486 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 13 | 188263 | 188433 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 14 | 1000063 | 1000224 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 15 | 1739252 | 1739422 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 16 | 799529 | 799705 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 17 | 2318598 | 2318759 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 18 | 2523603 | 2523764 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 19 | 845724 | 845888 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 20 | 1469271 | 1469432 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 21 | 1170615 | 1170782 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 22 | 2374448 | 2374609 | - | NZ_CP027770.1 | Staphylococcus felis |
| 23 | 1927043 | 1927210 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 24 | 943822 | 943983 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 25 | 1530461 | 1530622 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 26 | 1694997 | 1695158 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 27 | 352072 | 352233 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 28 | 1328741 | 1328899 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 29 | 1845976 | 1846134 | - | NZ_CP047361.1 | Macrococcus canis |
| 30 | 1909232 | 1909390 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 31 | 3075111 | 3075299 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134304.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.61 | 19 | 3113 | same-strand | ABC transporter |
| 2 | PF08838.12 | 0.81 | 25 | 2857 | same-strand | Protein of unknown function (DUF1811) |
| 3 | PF02631.18 | 0.97 | 30 | 2085.5 | same-strand | RecX family |
| 4 | PF00912.24 | 0.97 | 30 | 1051.0 | same-strand | Transglycosylase |
| 5 | PF01965.26 | 0.97 | 30 | 126.0 | same-strand | DJ-1/PfpI family |
| 6 | PF08756.12 | 0.94 | 29 | 154 | opposite-strand | YfkB-like domain |
| 7 | PF04055.23 | 0.84 | 26 | 152.5 | opposite-strand | Radical SAM superfamily |
| 8 | PF13394.8 | 0.94 | 29 | 154 | opposite-strand | 4Fe-4S single cluster domain |
| 9 | PF03061.24 | 0.94 | 29 | 1561 | same-strand | Thioesterase superfamily |
| 10 | PF02073.17 | 0.94 | 29 | 2161 | same-strand | Thermophilic metalloprotease (M29) |
| 11 | PF06569.13 | 0.84 | 26 | 3397.0 | same-strand | Protein of unknown function (DUF1128) |
| 12 | PF01451.23 | 0.77 | 24 | 3727.5 | opposite-strand | Low molecular weight phosphotyrosine protein phosphatase |
++ More..