Result : EXP02298
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02298 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1947506 |
| Right | 1947658 |
| Strand | - |
| Nucleotide Sequence | ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACGGATTTTGAAGATTTAAAAGAATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA |
| Sequence | MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1890657 | 1890809 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1935844 | 1935996 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1850416 | 1850571 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1500417 | 1500566 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00072.26 | 1.0 | 4 | 5089.0 | same-strand | Response regulator receiver domain |
| 2 | PF00196.21 | 1.0 | 4 | 5089.0 | same-strand | Bacterial regulatory proteins, luxR family |
| 3 | PF08281.14 | 0.75 | 3 | 5334 | same-strand | Sigma-70, region 4 |
| 4 | PF07730.15 | 1.0 | 4 | 3954.5 | same-strand | Histidine kinase |
| 5 | PF13185.8 | 1.0 | 4 | 3954.5 | same-strand | GAF domain |
| 6 | PF02518.28 | 1.0 | 4 | 3954.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 7 | PF00849.24 | 1.0 | 4 | 2974.0 | opposite-strand | RNA pseudouridylate synthase |
| 8 | PF00206.22 | 1.0 | 4 | 955.0 | same-strand | Lyase |
| 9 | PF10415.11 | 1.0 | 4 | 955.0 | same-strand | Fumarase C C-terminus |
| 10 | PF00588.21 | 1.0 | 4 | 788.5 | same-strand | SpoU rRNA Methylase family |
| 11 | PF08331.12 | 1.0 | 4 | 1261.5 | same-strand | Domain of unknown function (DUF1730) |
| 12 | PF13484.8 | 1.0 | 4 | 1261.5 | same-strand | 4Fe-4S double cluster binding domain |
| 13 | PF12838.9 | 1.0 | 4 | 1261.5 | same-strand | 4Fe-4S dicluster domain |
| 14 | PF00005.29 | 1.0 | 4 | 2553.0 | same-strand | ABC transporter |
| 15 | PF02463.21 | 0.75 | 3 | 2536 | same-strand | RecF/RecN/SMC N terminal domain |
| 16 | PF00497.22 | 0.75 | 3 | 3251 | same-strand | Bacterial extracellular solute-binding proteins, family 3 |
| 17 | PF00528.24 | 0.75 | 3 | 3251 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 18 | PF10613.11 | 0.75 | 3 | 3251 | same-strand | Ligated ion channel L-glutamate- and glycine-binding site |
++ More..