Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02298 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 1947506 |
Right | 1947658 |
Strand | - |
Nucleotide Sequence | ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACGGATTTTGAAGATTTAAAAGAATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA |
Sequence | MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 34061833 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 50 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1890657 | 1890809 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 1935844 | 1935996 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 1850416 | 1850571 | - | NZ_LT906460.1 | Staphylococcus simiae |
4 | 1500417 | 1500566 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00072.26 | 1.0 | 4 | 5089.0 | same-strand | Response regulator receiver domain |
2 | PF00196.21 | 1.0 | 4 | 5089.0 | same-strand | Bacterial regulatory proteins, luxR family |
3 | PF08281.14 | 0.75 | 3 | 5334 | same-strand | Sigma-70, region 4 |
4 | PF07730.15 | 1.0 | 4 | 3954.5 | same-strand | Histidine kinase |
5 | PF13185.8 | 1.0 | 4 | 3954.5 | same-strand | GAF domain |
6 | PF02518.28 | 1.0 | 4 | 3954.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
7 | PF00849.24 | 1.0 | 4 | 2974.0 | opposite-strand | RNA pseudouridylate synthase |
8 | PF00206.22 | 1.0 | 4 | 955.0 | same-strand | Lyase |
9 | PF10415.11 | 1.0 | 4 | 955.0 | same-strand | Fumarase C C-terminus |
10 | PF00588.21 | 1.0 | 4 | 788.5 | same-strand | SpoU rRNA Methylase family |
11 | PF08331.12 | 1.0 | 4 | 1261.5 | same-strand | Domain of unknown function (DUF1730) |
12 | PF13484.8 | 1.0 | 4 | 1261.5 | same-strand | 4Fe-4S double cluster binding domain |
13 | PF12838.9 | 1.0 | 4 | 1261.5 | same-strand | 4Fe-4S dicluster domain |
14 | PF00005.29 | 1.0 | 4 | 2553.0 | same-strand | ABC transporter |
15 | PF02463.21 | 0.75 | 3 | 2536 | same-strand | RecF/RecN/SMC N terminal domain |
16 | PF00497.22 | 0.75 | 3 | 3251 | same-strand | Bacterial extracellular solute-binding proteins, family 3 |
17 | PF00528.24 | 0.75 | 3 | 3251 | same-strand | Binding-protein-dependent transport system inner membrane component |
18 | PF10613.11 | 0.75 | 3 | 3251 | same-strand | Ligated ion channel L-glutamate- and glycine-binding site |