Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02297 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 2212090 |
Right | 2212227 |
Strand | - |
Nucleotide Sequence | ATGAAACGTCCTGAAAAGATTCAAAATGTAGTCAAACTATTGTCATCATTAGGTGTGAATATTAAAAAAACTAAATCTCGTTTAGACATTATTAATACTTTGCCAGCATCTAATAAAGTAAGTCACGAATTAAAATAA |
Sequence | MKRPEKIQNVVKLLSSLGVNIKKTKSRLDIINTLPASNKVSHELK |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 34061833 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 45 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2154431 | 2154568 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 2023805 | 2023942 | - | NZ_LT906460.1 | Staphylococcus simiae |
3 | 2110248 | 2110385 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
4 | 915356 | 915493 | + | NZ_AP018587.1 | Staphylococcus caprae |
5 | 1307976 | 1308113 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
6 | 88421 | 88558 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
7 | 878475 | 878612 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
8 | 591745 | 591882 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
9 | 837964 | 838101 | + | NZ_LR134242.1 | Staphylococcus warneri |
10 | 2389171 | 2389308 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
11 | 1657294 | 1657431 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
12 | 1625479 | 1625616 | + | NZ_CP033732.1 | Staphylococcus hominis |
13 | 914400 | 914540 | + | NZ_CP008724.1 | Staphylococcus xylosus |
14 | 1855542 | 1855682 | - | NZ_CP013114.1 | Staphylococcus equorum |
15 | 856875 | 857015 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
16 | 924497 | 924637 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
17 | 887695 | 887835 | + | NZ_CP064056.1 | Staphylococcus lloydii |
18 | 69295 | 69435 | + | NZ_CP018199.1 | Staphylococcus succinus |
19 | 726737 | 726856 | + | NZ_CP065712.1 | Staphylococcus auricularis |
20 | 2051426 | 2051566 | - | NZ_CP033460.1 | Staphylococcus debuckii |
21 | 1035000 | 1035140 | + | NZ_CP018776.1 | Staphylococcus condimenti |
22 | 1644824 | 1644934 | - | NZ_CP045927.1 | Staphylococcus agnetis |
23 | 829848 | 829958 | + | NZ_CP008747.1 | Staphylococcus hyicus |
24 | 486312 | 486428 | - | NZ_CP020773.1 | Staphylococcus lutrae |
25 | 1827441 | 1827557 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
26 | 17124 | 17234 | - | NZ_CP027770.1 | Staphylococcus felis |
27 | 1596461 | 1596601 | - | NZ_LT906464.1 | Staphylococcus muscae |
28 | 1562846 | 1562980 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
29 | 585601 | 585735 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
30 | 670110 | 670244 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00270.31 | 0.97 | 29 | 4612 | same-strand | DEAD/DEAH box helicase |
2 | PF00271.33 | 0.97 | 29 | 4612 | same-strand | Helicase conserved C-terminal domain |
3 | PF04851.17 | 0.97 | 29 | 4612 | same-strand | Type III restriction enzyme, res subunit |
4 | PF08245.14 | 0.97 | 29 | 2774 | same-strand | Mur ligase middle domain |
5 | PF02875.23 | 0.9 | 27 | 2773 | same-strand | Mur ligase family, glutamate ligase domain |
6 | PF01225.27 | 0.97 | 29 | 2774 | same-strand | Mur ligase family, catalytic domain |
7 | PF07478.15 | 1.0 | 30 | 1694.5 | same-strand | D-ala D-ala ligase C-terminus |
8 | PF01820.23 | 1.0 | 30 | 1694.5 | same-strand | D-ala D-ala ligase N-terminus |
9 | PF02222.24 | 1.0 | 30 | 1694.5 | same-strand | ATP-grasp domain |
10 | PF01098.21 | 1.0 | 30 | 155.5 | opposite-strand | Cell cycle protein |
11 | PF02583.19 | 0.9 | 27 | 431 | same-strand | Metal-sensitive transcriptional repressor |
12 | PF13091.8 | 1.0 | 30 | 838.0 | opposite-strand | PLD-like domain |
13 | PF00614.24 | 1.0 | 30 | 838.0 | opposite-strand | Phospholipase D Active site motif |
14 | PF13396.8 | 1.0 | 30 | 838.0 | opposite-strand | Phospholipase D-nuclease N-terminal |
15 | PF02096.22 | 0.7 | 21 | 3137 | same-strand | 60Kd inner membrane protein |
16 | PF03703.16 | 0.67 | 20 | 6191.0 | same-strand | Bacterial PH domain |