Result : EXP02296
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02296 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2151151 |
| Right | 2151285 |
| Strand | - |
| Nucleotide Sequence | ATGAGTTGTTTAATTTTAAGAATTTTTATCTTAATTAAGGAAGGAGTGATTTCAATGGCACAAGATATCATTTCAACAATCGGTGACTTAGTAAAATGGATTATCGACACAGTGAACAAATTCACTAAAAAATAA |
| Sequence | MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of PRK14752. Profile Description: delta-lysin family phenol-soluble modulin. The ORF matches to the profile of pfam05372. Profile Description: Delta lysin family. Delta-lysin is a 26 amino acid, hemolytic peptide toxin secreted by Staphylococcus aureus. It is thought that delta-toxin forms an amphipathic helix upon binding to lipid bilayers. The precise mode of action of delta-lysis is unclear. |
| Pubmed ID | 34061833 |
| Domain | CDD:173213,CDD:398831 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2093504 | 2093638 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2047907 | 2048041 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1967345 | 1967479 | - | NZ_LT906460.1 | Staphylococcus simiae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00166.23 | 1.0 | 3 | 4737 | same-strand | Chaperonin 10 Kd subunit |
| 2 | PF02517.18 | 1.0 | 3 | 3819 | opposite-strand | Type II CAAX prenyl endopeptidase Rce1-like |
| 3 | PF00881.26 | 1.0 | 3 | 1718 | opposite-strand | Nitroreductase family |
| 4 | PF00795.24 | 1.0 | 3 | 597 | opposite-strand | Carbon-nitrogen hydrolase |
| 5 | PF04647.17 | 1.0 | 3 | 182 | opposite-strand | Accessory gene regulator B |
| 6 | PF05931.13 | 1.0 | 3 | 802 | opposite-strand | Staphylococcal AgrD protein |
| 7 | PF14501.8 | 1.0 | 3 | 965 | opposite-strand | GHKL domain |
| 8 | PF00072.26 | 1.0 | 3 | 2267 | opposite-strand | Response regulator receiver domain |
| 9 | PF04397.17 | 1.0 | 3 | 2267 | opposite-strand | LytTr DNA-binding domain |
| 10 | PF00294.26 | 1.0 | 3 | 3324 | same-strand | pfkB family carbohydrate kinase |
++ More..