Result : EXP02288
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02288 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 293247 |
| Right | 293546 |
| Strand | + |
| Nucleotide Sequence | GTGCAAGTATTTGATGATTTATGGATGGATTTATATGATTTGTTTGAGGAATTAAGAAATTTATTTAAAGAAGAAGGACTAGAACCATGGACATCATGCGAATTTGATTTTACAAGAGAAGGTAAATTAAAAGTTTCATTTGATTATATTGATTGGATAAATTCAGAATTTGGTCAAGTAGGTCGACAAAATTACTATAAGTATAGAAAATTTGGAATTTTACCAGAAACGGAATATGAAATTAATAAAGTTAAAGAAATCGAGCAATATATTAAAGAGCAAGAAGAAGCTGAACTATAG |
| Sequence | VQVFDDLWMDLYDLFEELRNLFKEEGLEPWTSCEFDFTREGKLKVSFDYIDWINSEFGQVGRQNYYKYRKFGILPETEYEINKVKEIEQYIKEQEEAEL |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 292543 | 292842 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 2 | 291551 | 291820 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 292056 | 292331 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 4 | 295029 | 295310 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 5 | 296583 | 296831 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 6 | 296045 | 296332 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 7 | 293084 | 293344 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 8 | 289626 | 289916 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 9 | 292763 | 293062 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 10 | 293274 | 293573 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 11 | 293824 | 294084 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 12 | 292291 | 292551 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 13 | 294335 | 294583 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 14 | 878023 | 878277 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134304.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16883.7 | 1.0 | 3 | 1464.5 | same-strand | Domain of unknown function (DUF5080) |
| 2 | PF04634.14 | 1.0 | 3 | 1033 | same-strand | Protein of unknown function, DUF600 |
| 3 | PF16882.7 | 0.67 | 2 | 1609.5 | same-strand | Domain of unknown function (DUF5079) |
| 4 | PF14729.8 | 1.0 | 3 | 1633 | same-strand | Domain of unknown function with cystatin-like fold (DUF4467) |
| 5 | PF13273.8 | 1.0 | 3 | 1890.0 | same-strand | Protein of unknown function (DUF4064) |
| 6 | PF01226.19 | 0.67 | 2 | 2263 | opposite-strand | Formate/nitrite transporter |
| 7 | PF05525.15 | 0.67 | 2 | 3095.5 | opposite-strand | Branched-chain amino acid transport protein |
++ More..