Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02288 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 293247 |
Right | 293546 |
Strand | + |
Nucleotide Sequence | GTGCAAGTATTTGATGATTTATGGATGGATTTATATGATTTGTTTGAGGAATTAAGAAATTTATTTAAAGAAGAAGGACTAGAACCATGGACATCATGCGAATTTGATTTTACAAGAGAAGGTAAATTAAAAGTTTCATTTGATTATATTGATTGGATAAATTCAGAATTTGGTCAAGTAGGTCGACAAAATTACTATAAGTATAGAAAATTTGGAATTTTACCAGAAACGGAATATGAAATTAATAAAGTTAAAGAAATCGAGCAATATATTAAAGAGCAAGAAGAAGCTGAACTATAG |
Sequence | VQVFDDLWMDLYDLFEELRNLFKEEGLEPWTSCEFDFTREGKLKVSFDYIDWINSEFGQVGRQNYYKYRKFGILPETEYEINKVKEIEQYIKEQEEAEL |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 34061833 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 292543 | 292842 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
2 | 291551 | 291820 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 292056 | 292331 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
4 | 295029 | 295310 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
5 | 296583 | 296831 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
6 | 296045 | 296332 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
7 | 293084 | 293344 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
8 | 289626 | 289916 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
9 | 292763 | 293062 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
10 | 293274 | 293573 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
11 | 293824 | 294084 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
12 | 292291 | 292551 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
13 | 294335 | 294583 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
14 | 878023 | 878277 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF16883.7 | 1.0 | 3 | 1464.5 | same-strand | Domain of unknown function (DUF5080) |
2 | PF04634.14 | 1.0 | 3 | 1033 | same-strand | Protein of unknown function, DUF600 |
3 | PF16882.7 | 0.67 | 2 | 1609.5 | same-strand | Domain of unknown function (DUF5079) |
4 | PF14729.8 | 1.0 | 3 | 1633 | same-strand | Domain of unknown function with cystatin-like fold (DUF4467) |
5 | PF13273.8 | 1.0 | 3 | 1890.0 | same-strand | Protein of unknown function (DUF4064) |
6 | PF01226.19 | 0.67 | 2 | 2263 | opposite-strand | Formate/nitrite transporter |
7 | PF05525.15 | 0.67 | 2 | 3095.5 | opposite-strand | Branched-chain amino acid transport protein |