Result : EXP02287
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02287 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 869364 |
| Right | 869660 |
| Strand | + |
| Nucleotide Sequence | ATGAATAATTCATTAGACATCAAAGATGTAACTACATTTTATGAGGAAGACAAACATTTAATCTTTGGTTATACACCAACGTGTGGTACTTGTAAGGTTTCAGAAAGAATGTTAGACATTGCTAATGAAATATTGCAGTTACCATTATTGAAAATAGATTTAAACTTTTATCCTCAGTTTTGTAAAGATATGCAAATCATGTCTACGCCGATTTTATTGTTGATGAATAAAGATAAAGAAGTAAAACGAATTTATGCATTTAAATCGGTGACTGATTTGTTAGAAAATTTAAAATAG |
| Sequence | MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQFCKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. |
| Pubmed ID | 34061833 |
| Domain | CDD:412351 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 812574 | 812870 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 881655 | 881951 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1905652 | 1905948 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 4 | 2031126 | 2031422 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 5 | 1984893 | 1985189 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 6 | 2113074 | 2113370 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 7 | 830943 | 831239 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 8 | 171395 | 171691 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 9 | 916602 | 916901 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 10 | 2183842 | 2184141 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 11 | 309315 | 309638 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 12 | 427147 | 427446 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 13 | 2371099 | 2371398 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 14 | 699876 | 700145 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 15 | 885769 | 886068 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 16 | 1854515 | 1854838 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 17 | 1398277 | 1398573 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 18 | 2034141 | 2034440 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 19 | 1931589 | 1931831 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 20 | 1934710 | 1935033 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 21 | 1249886 | 1250185 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 22 | 1338968 | 1339282 | + | NZ_CP027770.1 | Staphylococcus felis |
| 23 | 581006 | 581302 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 24 | 1793937 | 1794176 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 25 | 1827761 | 1828072 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 26 | 572447 | 572764 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 27 | 2009207 | 2009449 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 28 | 503605 | 503901 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 29 | 535651 | 535899 | + | NZ_LT906464.1 | Staphylococcus muscae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022737.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03960.17 | 1.0 | 29 | 1153 | same-strand | ArsC family |
| 2 | PF01597.21 | 1.0 | 29 | 623 | same-strand | Glycine cleavage H-protein |
| 3 | PF00005.29 | 1.0 | 29 | 250 | same-strand | ABC transporter |
| 4 | PF09383.12 | 1.0 | 29 | 249 | same-strand | NIL domain |
| 5 | PF13401.8 | 0.86 | 25 | 249 | same-strand | AAA domain |
| 6 | PF00528.24 | 0.97 | 28 | 1267.0 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 7 | PF03180.16 | 1.0 | 29 | 1984.0 | same-strand | NlpA lipoprotein |
| 8 | PF00085.22 | 0.97 | 28 | 1638.5 | opposite-strand | Thioredoxin |
| 9 | PF01751.24 | 0.83 | 24 | -7.0 | same-strand | Toprim domain |
| 10 | PF00881.26 | 0.93 | 27 | 2060 | same-strand | Nitroreductase family |
++ More..