Result : EXP02286
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02286 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 44229 |
| Right | 44525 |
| Strand | + |
| Nucleotide Sequence | ATGGCGACTAAGAAAGATGTACATGATTTATTTTTAAATCATGTGAATTCAAACGCGGTTAAGACAAGAAAGATGATGGGAGAATATATTATTTATTATGATGGCGTGGTTATAGGTGGTTTGTATGATAATAGATTATTGGTCAAGGCGACTAAAAGTGCCCAGCAGAAATTGCAAGATAATACATTAGTTTCGCCATATCCAGGTTCTAAAGAAATGATATTAATTCTAGACTTTACCGAAGCAACAAATCTCACTGATTTATTTAAGACCATAAAAAATGATTTGAAAAAGTGA |
| Sequence | MATKKDVHDLFLNHVNSNAVKTRKMMGEYIIYYDGVVIGGLYDNRLLVKATKSAQQKLQDNTLVSPYPGSKEMILILDFTEATNLTDLFKTIKNDLKK |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl17592. Profile Description: TfoX N-terminal domain. TfoX may play a key role in the development of genetic competence by regulating the expression of late competence-specific genes. This family corresponds to the N-terminal presumed domain of TfoX. The domain is found as an isolated domain in some proteins suggesting this is an autonomous domain. |
| Pubmed ID | 34061833 |
| Domain | CDD:418453 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 44228 | 44524 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 44652 | 44948 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2464758 | 2465051 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01207.19 | 0.67 | 2 | 564.0 | opposite-strand | Dihydrouridine synthase (Dus) |
++ More..