Result : EXP02285
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02285 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1323479 |
| Right | 1323772 |
| Strand | + |
| Nucleotide Sequence | ATGAAAGACACATTAATGAGTATACAAATAATTCCTAAAACACCAAACAATGACAATGTTATACCTTACGTAGACGAGGCGATTAAAATAATTGACGAATCTGGTTTGCATTTTAGAGTAGGTCCGTTAGAAACGACAGTACAAGGAAATATGAATGAATGTTTAATTTTAATACAATCATTAAATGAACGAATGGTGGAACTTGAATGTCCAAGTATTATTAGCCAAGTTAAGTTTTATCATGTGCCAGATGGCATCACTATTGAAACTTTAACTGAAAAATATGATGAATAA |
| Sequence | MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQSLNERMVELECPSIISQVKFYHVPDGITIETLTEKYDE |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00307. Profile Description: Thiamine-binding protein. This protein has been crystallized in both Methanobacterium thermoautotrophicum and yeast, but its function remains unknown. Both crystal structures showed sulfate ions bound at the interface of two dimers to form a tetramer. [Unknown function, General] |
| Pubmed ID | 34061833 |
| Domain | CDD:412296 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 74
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1223523 | 1223816 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1294315 | 1294605 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 29682 | 29978 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 4 | 954864 | 955160 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 5 | 1251743 | 1252033 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 6 | 1600684 | 1600974 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 7 | 1663686 | 1663982 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 8 | 606372 | 606668 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 9 | 1541276 | 1541572 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 10 | 2439382 | 2439678 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 11 | 490350 | 490643 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 12 | 1775398 | 1775688 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 13 | 1635796 | 1636092 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 14 | 849202 | 849498 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 15 | 1153091 | 1153387 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 16 | 1563058 | 1563339 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 17 | 1541052 | 1541348 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 18 | 1774696 | 1774986 | + | NZ_CP027770.1 | Staphylococcus felis |
| 19 | 1396225 | 1396521 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 20 | 2292299 | 2292604 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 21 | 1393036 | 1393326 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 22 | 255242 | 255547 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 23 | 1083359 | 1083658 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 24 | 941446 | 941742 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 25 | 1619358 | 1619654 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 26 | 1701094 | 1701384 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 27 | 1462309 | 1462593 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 28 | 791599 | 791889 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 29 | 1370839 | 1371129 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 30 | 2099436 | 2099726 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 31 | 1072134 | 1072421 | + | NZ_CP047361.1 | Macrococcus canis |
| 32 | 3097504 | 3097794 | + | NZ_CP012024.1 | Bacillus smithii |
| 33 | 628789 | 629088 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 34 | 642285 | 642572 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 35 | 82674 | 82964 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 36 | 2229976 | 2230236 | + | NZ_CP034118.1 | Staphylospora marina |
| 37 | 1875265 | 1875555 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 38 | 1175415 | 1175702 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 39 | 2235255 | 2235557 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 40 | 1316035 | 1316325 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 41 | 2537140 | 2537430 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 42 | 272501 | 272791 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 43 | 1489594 | 1489884 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 44 | 3808813 | 3809103 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 45 | 4317941 | 4318231 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 46 | 521813 | 522106 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 47 | 1087422 | 1087706 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 48 | 697403 | 697693 | + | NZ_LS483476.1 | Lederbergia lentus |
| 49 | 4513103 | 4513405 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 50 | 2403474 | 2403767 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 51 | 4568772 | 4569065 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 52 | 582850 | 583143 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 53 | 473192 | 473485 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 54 | 2425609 | 2425902 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 55 | 60247 | 60543 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 56 | 2635237 | 2635530 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 57 | 2238440 | 2238730 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 58 | 354326 | 354619 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 59 | 391750 | 392043 | - | NZ_CP009288.1 | Paenibacillus durus |
| 60 | 4072757 | 4073041 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 61 | 350404 | 350694 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 62 | 395836 | 396129 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 63 | 1083466 | 1083756 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 64 | 7496538 | 7496831 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 65 | 3421776 | 3422069 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 66 | 6773439 | 6773732 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 67 | 7505 | 7798 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 68 | 1989734 | 1990024 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 69 | 5137111 | 5137404 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 70 | 3126997 | 3127296 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 71 | 910005 | 910295 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 72 | 3368480 | 3368770 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 73 | 3284585 | 3284878 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 74 | 2305388 | 2305681 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906462.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.65 | 48 | 786.5 | same-strand | ABC transporter |
++ More..