Result : EXP02283
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02283 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1003696 |
| Right | 1003983 |
| Strand | + |
| Nucleotide Sequence | ATGGAAAAGGGGATTTTCAATTACGATAATGCGAATGTATTAAAATTAGATACTAATCAGTTAAATGAAAACATAAAAGTCATTGACGATATATTTAAAAATTATGAGCAGATAGAGCCAACTATAGAAGTCGAAAATGGAAATACAAAATTAAAATTAAATGGATATTTTATTGCGTCAATTATAAGCCCATTAAATTTAAATAAACTTAATAATTTATATGTTGAAGAAGAATTTTATCATACATATAACGAATTAATTGTTAAATATACTGAGGTAAAGGAATAA |
| Sequence | MEKGIFNYDNANVLKLDTNQLNENIKVIDDIFKNYEQIEPTIEVENGNTKLKLNGYFIASIISPLNLNKLNNLYVEEEFYHTYNELIVKYTEVKE |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 946912 | 947199 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1017209 | 1017496 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02517.18 | 1.0 | 2 | 4913.5 | same-strand | Type II CAAX prenyl endopeptidase Rce1-like |
| 2 | PF07242.13 | 1.0 | 2 | 1626.0 | same-strand | Protein of unknown function (DUF1430) |
| 3 | PF00005.29 | 1.0 | 2 | 665.0 | same-strand | ABC transporter |
| 4 | PF00534.22 | 1.0 | 2 | 356.0 | same-strand | Glycosyl transferases group 1 |
| 5 | PF13692.8 | 1.0 | 2 | 356.0 | same-strand | Glycosyl transferases group 1 |
| 6 | PF13524.8 | 1.0 | 2 | 356.0 | same-strand | Glycosyl transferases group 1 |
| 7 | PF07681.14 | 1.0 | 2 | 1575.5 | opposite-strand | DoxX |
| 8 | PF13564.8 | 1.0 | 2 | 1575.5 | opposite-strand | DoxX-like family |
| 9 | PF01497.20 | 1.0 | 2 | 2408.0 | same-strand | Periplasmic binding protein |
++ More..