Result : EXP02282
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02282 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2613223 |
| Right | 2613504 |
| Strand | + |
| Nucleotide Sequence | GTGACATATCATGAGCGTGTTTTAGCATTAAGAGCAGAAAGTAAAAGAACCGCATTTGATTTTCGATTCGAAGATTTATTTAGCAAAGAAGAATGGCTAAGTATGTCTCTTGCAGAAAGACAAAAAGCTGAAAAAGCATTTCGACACGAAGTTAAAAATATGGACGATGTAAGAATGCCCTTCTCAAGTGTCCATGACGCCCAAGTAAAATTATATAATGTTGTATATTCTTATAACGGCATTAAACGTAATTTTAAACAAGTTGAAAATGAAGGATTCTAA |
| Sequence | VTYHERVLALRAESKRTAFDFRFEDLFSKEEWLSMSLAERQKAEKAFRHEVKNMDDVRMPFSSVHDAQVKLYNVVYSYNGIKRNFKQVENEGF |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam07205. Profile Description: Domain of unknown function (DUF1413). This family consists of several hypothetical bacterial proteins which seem to be specific to firmicute species. Members of this family are typically around 100 residues in length. The function of this family is unknown. |
| Pubmed ID | 34061833 |
| Domain | CDD:399883 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2555392 | 2555673 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2514473 | 2514754 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2393249 | 2393530 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1670583 | 1670885 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 5 | 1013587 | 1013874 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 422117 | 422416 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 7 | 458810 | 459097 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 8 | 551033 | 551335 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 9 | 1976003 | 1976269 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 10 | 1290957 | 1291235 | - | NZ_CP033732.1 | Staphylococcus hominis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007601.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00106.27 | 1.0 | 10 | 232 | opposite-strand | short chain dehydrogenase |
| 2 | PF13561.8 | 0.9 | 9 | 260.5 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 3 | PF08659.12 | 1.0 | 10 | 232 | opposite-strand | KR domain |
| 4 | PF13460.8 | 0.9 | 9 | 193 | opposite-strand | NAD(P)H-binding |
| 5 | PF03435.20 | 0.8 | 8 | 201.5 | opposite-strand | Saccharopine dehydrogenase NADP binding domain |
| 6 | PF13091.8 | 0.8 | 8 | 2351.0 | same-strand | PLD-like domain |
| 7 | PF02541.18 | 0.7 | 7 | 4578 | same-strand | Ppx/GppA phosphatase family |
| 8 | PF17941.3 | 0.7 | 7 | 2349 | same-strand | Polyphosphate kinase C-terminal domain 1 |
| 9 | PF13090.8 | 0.7 | 7 | 2349 | same-strand | Polyphosphate kinase C-terminal domain 2 |
| 10 | PF02503.19 | 0.7 | 7 | 2349 | same-strand | Polyphosphate kinase middle domain |
| 11 | PF13089.8 | 0.7 | 7 | 2349 | same-strand | Polyphosphate kinase N-terminal domain |
| 12 | PF01546.30 | 0.7 | 7 | 991 | opposite-strand | Peptidase family M20/M25/M40 |
| 13 | PF07687.16 | 0.7 | 7 | 991 | opposite-strand | Peptidase dimerisation domain |
++ More..