Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02281 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 235323 |
Right | 235601 |
Strand | + |
Nucleotide Sequence | ATGAAACAAGTATTAGTAGCGTGTGGTGCAGGTATTGCAACGTCAACAGTAGTAAATAATGCAATTGAAGAAATGGCAAAGGAACACAATATTAAAGTAGATATTAAACAAATCAAAATTACAGAAGTTGGACCTTATGAAGACACTGCAGATTTATTAGTTACAACTGCAATGACAAAAAAAGAATATAAATTCCCAGTTATCAACGCACGTAATTTCTTAACTGGTATTGGTATTGAAGAAACAAAACAACAAATCTTAACAGAGTTACAAAAATAA |
Sequence | MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTKKEYKFPVINARNFLTGIGIEETKQQILTELQK |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl10014. Profile Description: N/A. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The lactose/cellobiose-specific family are one of four structurally and functionally distinct group IIB PTS system cytoplasmic enzymes. The fold of IIB cellobiose shows similar structure to mammalian tyrosine phosphatases. This family also contains the fructose specific IIB subunit. |
Pubmed ID | 34061833 |
Domain | CDD:415825 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 237521 | 237799 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
2 | 235347 | 235625 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
3 | 251792 | 252070 | + | NZ_LT906460.1 | Staphylococcus simiae |
4 | 280338 | 280616 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
5 | 1996511 | 1996789 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
6 | 2825672 | 2825950 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
7 | 125756 | 126034 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
8 | 2595455 | 2595733 | + | NZ_CP013114.1 | Staphylococcus equorum |
9 | 1275641 | 1275907 | + | NZ_CP022437.1 | Virgibacillus necropolis |
10 | 2465290 | 2465568 | - | NZ_CP011366.1 | Salinicoccus halodurans |
11 | 2053864 | 2054142 | - | NZ_CP018199.1 | Staphylococcus succinus |
12 | 3241826 | 3242092 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
13 | 208899 | 209168 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
14 | 2178888 | 2179154 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
15 | 4139200 | 4139427 | - | NZ_CP020772.1 | Halobacillus mangrovi |
16 | 12523 | 12750 | - | NZ_CP020772.1 | Halobacillus mangrovi |
17 | 4138876 | 4139103 | - | NZ_CP020772.1 | Halobacillus mangrovi |
18 | 12199 | 12426 | - | NZ_CP020772.1 | Halobacillus mangrovi |
19 | 2084833 | 2085060 | - | NZ_CP008876.1 | Terribacillus goriensis |
20 | 915040 | 915267 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
21 | 2637698 | 2637982 | + | NZ_CP019699.1 | Novibacillus thermophilus |
22 | 282684 | 282950 | + | NZ_CP012024.1 | Bacillus smithii |
23 | 2064463 | 2064690 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
24 | 104998 | 105282 | + | NZ_CP017703.1 | Aeribacillus pallidus |
25 | 1332980 | 1333207 | + | NZ_CP009285.1 | Paenibacillus borealis |
26 | 2066714 | 2067007 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
27 | 108871 | 109104 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
28 | 1840326 | 1840610 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
29 | 668691 | 669014 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
30 | 2821928 | 2822212 | + | NZ_CP043998.1 | Clostridium diolis |
31 | 391898 | 392137 | - | NZ_CP043405.1 | Streptococcus ratti |
32 | 2757018 | 2757257 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
33 | 2736518 | 2736754 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
34 | 813454 | 813726 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
35 | 2021800 | 2022024 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
36 | 316480 | 316716 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
37 | 1790985 | 1791224 | - | NZ_CP014699.1 | Streptococcus pantholopis |
38 | 2314448 | 2314687 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
39 | 1741800 | 1742030 | - | NZ_CP014161.1 | Aerococcus urinae |
40 | 153834 | 154067 | + | NZ_CP022680.1 | Streptococcus respiraculi |
41 | 1633066 | 1633293 | + | NZ_AP018437.1 | Pelolinea submarina |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00874.22 | 0.92 | 35 | 564 | same-strand | PRD domain |
2 | PF00359.24 | 1.0 | 38 | 489.0 | same-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
3 | PF03611.16 | 1.0 | 38 | 76.5 | same-strand | PTS system sugar-specific permease component |
4 | PF08240.14 | 0.89 | 34 | 1648.0 | same-strand | Alcohol dehydrogenase GroES-like domain |
5 | PF00107.28 | 0.89 | 34 | 1648.0 | same-strand | Zinc-binding dehydrogenase |
6 | PF16912.7 | 0.89 | 34 | 1496 | same-strand | Glucose dehydrogenase C-terminus |
7 | PF13602.8 | 0.79 | 30 | 1648.0 | same-strand | Zinc-binding dehydrogenase |