Result : EXP02280
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02280 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2735184 |
| Right | 2735459 |
| Strand | + |
| Nucleotide Sequence | ATGACTAAAGAAACAGATAATAAAAAAACAGTAGCGACTTCTGACAACAAAGACACACAGCAACAAAATCAACCTGAAGAAGATGAACGTCAAGGTTTGAATGGTTATCGTAAAACAGATCTTGATTTAGAAATCGAGCAAGAGCTACGTGAAATGATGAAAACAGGAGAAAATGAAACGAAAAATGACTATAAAAAGTTTAAAGTGTTTTCACTTATTTCAACACTTGTCATTGTCATTTTAGCAATTATAAGATTTGTTCATAAAATGATGTAA |
| Sequence | MTKETDNKKTVATSDNKDTQQQNQPEEDERQGLNGYRKTDLDLEIEQELREMMKTGENETKNDYKKFKVFSLISTLVIVILAIIRFVHKMM |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2677700 | 2677975 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2638775 | 2639050 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2499748 | 2500023 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 441939 | 442160 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 5 | 1776785 | 1777057 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 6 | 342262 | 342519 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 7 | 1132575 | 1132832 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP018587.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03881.16 | 1.0 | 7 | 1437 | opposite-strand | Fructosamine kinase |
| 2 | PF01636.25 | 1.0 | 7 | 1437 | opposite-strand | Phosphotransferase enzyme family |
| 3 | PF01180.23 | 1.0 | 7 | 139 | same-strand | Dihydroorotate dehydrogenase |
| 4 | PF02677.16 | 1.0 | 7 | 79 | opposite-strand | Epoxyqueuosine reductase QueH |
| 5 | PF06983.15 | 1.0 | 7 | 1285 | same-strand | 3-demethylubiquinone-9 3-methyltransferase |
| 6 | PF14278.8 | 0.86 | 6 | 1803.5 | opposite-strand | Transcriptional regulator C-terminal region |
| 7 | PF00440.25 | 0.71 | 5 | 1792 | opposite-strand | Bacterial regulatory proteins, tetR family |
| 8 | PF08530.12 | 0.86 | 6 | 2528.5 | same-strand | X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain |
| 9 | PF12697.9 | 0.71 | 5 | 4139 | same-strand | Alpha/beta hydrolase family |
| 10 | PF04909.16 | 0.71 | 5 | 2656 | same-strand | Amidohydrolase |
++ More..