Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02278 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 1156675 |
Right | 1156941 |
Strand | + |
Nucleotide Sequence | ATGACACAGTTTAAAAACAAGGTAAATGTATCAATTAATGATCAGCTTTTTACAATTGTTGGGGAAGATAACCCAGAGCACATACGATATGTAGCACATTTAGTTGATGATAAAATAAAAGAATTAGGGTATAAAGCAGCAGGTTTAGATACTTCAAGAAAAGCAATACTAACTGCTGTGAATATTATGCATGAAAAAGTACTACTAGAAGAAGAAAATCGACGTTTGAAACAACAAATTCACAAATTGCAGCAGCGTGAGCAATAA |
Sequence | MTQFKNKVNVSINDQLFTIVGEDNPEHIRYVAHLVDDKIKELGYKAAGLDTSRKAILTAVNIMHEKVLLEEENRRLKQQIHKLQQREQ |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl01146. Profile Description: Cell division protein ZapA. cell division protein ZapA; Provisional |
Pubmed ID | 34061833 |
Domain | CDD:412769 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 88 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1128097 | 1128363 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
2 | 1099190 | 1099456 | + | NZ_LT906460.1 | Staphylococcus simiae |
3 | 1056822 | 1057082 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
4 | 1749675 | 1749941 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
5 | 1862110 | 1862376 | - | NZ_AP018587.1 | Staphylococcus caprae |
6 | 454136 | 454402 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
7 | 1627438 | 1627704 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
8 | 937526 | 937792 | + | NZ_CP013114.1 | Staphylococcus equorum |
9 | 106275 | 106544 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
10 | 803879 | 804145 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
11 | 1803573 | 1803839 | - | NZ_CP008724.1 | Staphylococcus xylosus |
12 | 1185263 | 1185529 | + | NZ_CP033460.1 | Staphylococcus debuckii |
13 | 2291467 | 2291733 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
14 | 1689564 | 1689830 | - | NZ_LR134242.1 | Staphylococcus warneri |
15 | 1883130 | 1883396 | - | NZ_CP018776.1 | Staphylococcus condimenti |
16 | 1020807 | 1021076 | - | NZ_CP018199.1 | Staphylococcus succinus |
17 | 1711408 | 1711677 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
18 | 184328 | 184594 | - | NZ_CP033732.1 | Staphylococcus hominis |
19 | 750715 | 750981 | + | NZ_LT906464.1 | Staphylococcus muscae |
20 | 1719226 | 1719495 | - | NZ_CP064056.1 | Staphylococcus lloydii |
21 | 644760 | 645017 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
22 | 1548588 | 1548842 | - | NZ_CP065712.1 | Staphylococcus auricularis |
23 | 1605010 | 1605276 | + | NZ_CP027770.1 | Staphylococcus felis |
24 | 1782515 | 1782781 | - | NZ_CP008747.1 | Staphylococcus hyicus |
25 | 2098324 | 2098590 | + | NZ_CP020773.1 | Staphylococcus lutrae |
26 | 731454 | 731720 | + | NZ_CP045927.1 | Staphylococcus agnetis |
27 | 885811 | 886077 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
28 | 1652134 | 1652406 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
29 | 1634509 | 1634784 | - | NZ_CP054482.1 | Macrococcus bohemicus |
30 | 1642164 | 1642421 | - | NZ_CP011366.1 | Salinicoccus halodurans |
31 | 1514223 | 1514495 | - | NZ_CP047361.1 | Macrococcus canis |
32 | 233647 | 233919 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
33 | 1564345 | 1564617 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
34 | 2464090 | 2464362 | - | NZ_CP012024.1 | Bacillus smithii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00588.21 | 0.91 | 31 | 5207 | same-strand | SpoU rRNA Methylase family |
2 | PF08032.14 | 0.91 | 31 | 5207 | same-strand | RNA 2'-O ribose methyltransferase substrate binding |
3 | PF01409.22 | 0.97 | 33 | 3734 | same-strand | tRNA synthetases class II core domain (F) |
4 | PF02912.20 | 0.97 | 33 | 3734 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
5 | PF17759.3 | 0.97 | 33 | 1340.0 | same-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
6 | PF03483.19 | 0.97 | 33 | 1325 | same-strand | B3/4 domain |
7 | PF03147.16 | 0.97 | 33 | 1325 | same-strand | Ferredoxin-fold anticodon binding domain |
8 | PF01588.22 | 0.97 | 33 | 1325 | same-strand | Putative tRNA binding domain |
9 | PF03484.17 | 0.97 | 33 | 1325 | same-strand | tRNA synthetase B5 domain |
10 | PF01351.20 | 1.0 | 34 | 263.5 | opposite-strand | Ribonuclease HII |
11 | PF11858.10 | 0.97 | 33 | 263 | opposite-strand | Domain of unknown function (DUF3378) |
12 | PF02674.18 | 1.0 | 34 | 1.0 | same-strand | Colicin V production protein |
13 | PF14716.8 | 1.0 | 34 | 597.0 | same-strand | Helix-hairpin-helix domain |
14 | PF14791.8 | 1.0 | 34 | 597.0 | same-strand | DNA polymerase beta thumb |
15 | PF14520.8 | 1.0 | 34 | 623.0 | same-strand | Helix-hairpin-helix domain |
16 | PF00488.23 | 1.0 | 34 | 2322.5 | same-strand | MutS domain V |
17 | PF01713.23 | 1.0 | 34 | 2322.5 | same-strand | Smr domain |
18 | PF00085.22 | 0.97 | 33 | 4838 | same-strand | Thioredoxin |
19 | PF13098.8 | 0.97 | 33 | 4838 | same-strand | Thioredoxin-like domain |
20 | PF08459.13 | 0.85 | 29 | 5297 | same-strand | UvrC RIbonuclease H-like domain |
21 | PF01541.26 | 0.85 | 29 | 5297 | same-strand | GIY-YIG catalytic domain |
22 | PF02151.21 | 0.85 | 29 | 5297 | same-strand | UvrB/uvrC motif |