Result : EXP02277
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02277 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2172937 |
| Right | 2173191 |
| Strand | + |
| Nucleotide Sequence | ATGACAAGAATTCTTAAATTACAAGTTGCGGATCAAGTCAGCACGCTAAATCGAATTACAAGTGCTTTTGTTCGCCTACAATATAATATCGATACATTACATGTTACACATTCTGAACAACCTGGGATTTCTAACATGGAAATTCAAGTCGATATTCAAGATGATACATCACTTCATATATTAATTAAAAAATTAAAACAACAAATTAATGTTTTAACGGTTGAATGCTACGACCTTGTTGATAACGAAGCTTAA |
| Sequence | MTRILKLQVADQVSTLNRITSAFVRLQYNIDTLHVTHSEQPGISNMEIQVDIQDDTSLHILIKKLKQQINVLTVECYDLVDNEA |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl09141. Profile Description: ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain is a structural motif of 70-90 amino acids that functions in the control of metabolism, solute transport and signal transduction. They are thus found in a variety of different proteins in a variety of different arrangements. In mammalian phenylalanine hydroxylase the domain forms no contacts but promotes an allosteric effect despite the apparent lack of ligand binding. |
| Pubmed ID | 34061833 |
| Domain | CDD:415594 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2115291 | 2115545 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2069793 | 2070047 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1989088 | 1989342 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 945470 | 945703 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 5 | 58541 | 58774 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 6 | 908696 | 908929 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 7 | 1277884 | 1278117 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 8 | 867518 | 867760 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 9 | 561762 | 562004 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 10 | 1623524 | 1623766 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 11 | 1654790 | 1655029 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 12 | 2420175 | 2420408 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00583.27 | 0.83 | 10 | 5040.5 | opposite-strand | Acetyltransferase (GNAT) family |
| 2 | PF13508.9 | 0.83 | 10 | 5040.5 | opposite-strand | Acetyltransferase (GNAT) domain |
| 3 | PF13302.9 | 0.75 | 9 | 5025 | opposite-strand | Acetyltransferase (GNAT) domain |
| 4 | PF02367.19 | 0.92 | 11 | 3945 | opposite-strand | Threonylcarbamoyl adenosine biosynthesis protein TsaE |
| 5 | PF00920.23 | 0.92 | 11 | 1791 | same-strand | Dehydratase family |
| 6 | PF02776.20 | 0.92 | 11 | 0 | same-strand | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain |
| 7 | PF02775.23 | 1.0 | 12 | 0.0 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 8 | PF00205.24 | 0.92 | 11 | 0 | same-strand | Thiamine pyrophosphate enzyme, central domain |
| 9 | PF07991.14 | 0.92 | 11 | 133 | same-strand | Acetohydroxy acid isomeroreductase, NADPH-binding domain |
| 10 | PF01450.21 | 0.92 | 11 | 133 | same-strand | Acetohydroxy acid isomeroreductase, catalytic domain |
| 11 | PF03807.19 | 0.67 | 8 | 133.0 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
| 12 | PF00682.21 | 1.0 | 12 | 1159.0 | same-strand | HMGL-like |
| 13 | PF08502.12 | 0.92 | 11 | 1159 | same-strand | LeuA allosteric (dimerisation) domain |
| 14 | PF00180.22 | 0.92 | 11 | 2691 | same-strand | Isocitrate/isopropylmalate dehydrogenase |
| 15 | PF00330.22 | 0.92 | 11 | 3750 | same-strand | Aconitase family (aconitate hydratase) |
| 16 | PF00694.21 | 0.92 | 11 | 5121 | same-strand | Aconitase C-terminal domain |
++ More..