Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02275 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 3677 |
Right | 3922 |
Strand | + |
Nucleotide Sequence | GTGATTATTTTGGTTCAAGAAGTTGTAGTAGAAGGAGACATTAATTTAGGTCAATTTCTAAAAACAGAAGGGATTATTGAATCTGGTGGTCAAGCAAAATGGTTCTTGCAAGACGTTGAAGTATTAATTAATGGAGTGCGTGAAACACGTCGCGGTAAAAAGTTAGAACATCAAGATCGTATAGATATCCCAGAATTACCTGAAGATGCTGGTTCTTTCTTAATCATTCATCAAGGTGAACAATGA |
Sequence | VIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl09940. Profile Description: N/A. This domain is found at the C-terminus of fungal tyrosyl-tRNA synthetases. It binds to group I introns. |
Pubmed ID | 34061833 |
Domain | CDD:415814 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3142 | 3387 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
2 | 3670 | 3915 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
3 | 2131923 | 2132168 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
4 | 3698 | 3943 | + | NZ_AP018587.1 | Staphylococcus caprae |
5 | 3152 | 3397 | + | NZ_LR134242.1 | Staphylococcus warneri |
6 | 1486809 | 1487054 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
7 | 3231 | 3467 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
8 | 907520 | 907765 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
9 | 3132 | 3368 | + | NZ_LT906460.1 | Staphylococcus simiae |
10 | 2545726 | 2545968 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
11 | 844100 | 844342 | + | NZ_CP033732.1 | Staphylococcus hominis |
12 | 1431852 | 1432094 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
13 | 1963805 | 1964038 | + | NZ_CP018199.1 | Staphylococcus succinus |
14 | 1840324 | 1840566 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
15 | 2818485 | 2818718 | - | NZ_CP013114.1 | Staphylococcus equorum |
16 | 3296 | 3529 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
17 | 3900 | 4133 | + | NZ_CP008724.1 | Staphylococcus xylosus |
18 | 3698 | 3931 | + | NZ_CP064056.1 | Staphylococcus lloydii |
19 | 130495 | 130728 | - | NZ_CP065712.1 | Staphylococcus auricularis |
20 | 206076 | 206300 | + | NZ_CP033460.1 | Staphylococcus debuckii |
21 | 3614 | 3838 | + | NZ_CP018776.1 | Staphylococcus condimenti |
22 | 2613402 | 2613632 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
23 | 608667 | 608897 | + | NZ_CP027770.1 | Staphylococcus felis |
24 | 6750 | 6980 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
25 | 16666 | 16896 | - | NZ_CP045927.1 | Staphylococcus agnetis |
26 | 3821 | 4051 | + | NZ_CP008747.1 | Staphylococcus hyicus |
27 | 2229385 | 2229615 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
28 | 2503177 | 2503407 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
29 | 3646 | 3876 | + | NZ_LT906464.1 | Staphylococcus muscae |
30 | 1305183 | 1305413 | - | NZ_CP020773.1 | Staphylococcus lutrae |
31 | 888817 | 889047 | - | NZ_CP053988.1 | Abiotrophia defectiva |
32 | 3204 | 3407 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
33 | 1892331 | 1892540 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
34 | 2928 | 3155 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
35 | 3283 | 3504 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
36 | 3226 | 3447 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
37 | 3260 | 3487 | + | NZ_CP053421.1 | Pediococcus acidilactici |
38 | 1086640 | 1086855 | + | NZ_CP046314.1 | Gemella morbillorum |
39 | 1026862 | 1027080 | - | NZ_CP053187.1 | Turicibacter sanguinis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00308.20 | 0.87 | 34 | 1815.5 | same-strand | Bacterial dnaA protein |
2 | PF08299.13 | 0.87 | 34 | 1815.5 | same-strand | Bacterial dnaA protein helix-turn-helix |
3 | PF11638.10 | 0.79 | 31 | 1818 | same-strand | DnaA N-terminal domain |
4 | PF00004.31 | 0.82 | 32 | 1821.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
5 | PF00712.21 | 0.87 | 34 | 381.5 | same-strand | DNA polymerase III beta subunit, N-terminal domain |
6 | PF02767.18 | 0.87 | 34 | 381.5 | same-strand | DNA polymerase III beta subunit, central domain |
7 | PF02768.17 | 0.87 | 34 | 381.5 | same-strand | DNA polymerase III beta subunit, C-terminal domain |
8 | PF02463.21 | 1.0 | 39 | -3 | same-strand | RecF/RecN/SMC N terminal domain |
9 | PF13476.8 | 0.85 | 33 | -3 | same-strand | AAA domain |
10 | PF00204.27 | 1.0 | 39 | 1134 | same-strand | DNA gyrase B |
11 | PF00986.23 | 1.0 | 39 | 1134 | same-strand | DNA gyrase B subunit, carboxyl terminus |
12 | PF02518.28 | 1.0 | 39 | 1134 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
13 | PF01751.24 | 1.0 | 39 | 1134 | same-strand | Toprim domain |
14 | PF00521.22 | 1.0 | 39 | 3094 | same-strand | DNA gyrase/topoisomerase IV, subunit A |
15 | PF03989.15 | 1.0 | 39 | 3094 | same-strand | DNA gyrase C-terminal domain, beta-propeller |
16 | PF01256.19 | 0.74 | 29 | 5857 | opposite-strand | Carbohydrate kinase |