Result : EXP02272
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02272 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 897528 |
| Right | 897764 |
| Strand | + |
| Nucleotide Sequence | ATGAATCCGATCGTAGAATTTTGTCTCTCTAACATGGCAAAAGGTGGAGATTATGTTTTTAATCAACTGGAAAATGACCCAGATGTCGATGTGTTAGAGTATGGTTGCCTGACACATTGTGGTATATGTTCAGCCGGGTTGTATGCTTTAGTAAATGGTGATATTGTTGAAGGTGATTCGCCGGAAGAATTATTACAAAATATATATGCACATATAAAAGAAACTTGGATTTTTTAA |
| Sequence | MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGDSPEELLQNIYAHIKETWIF |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl11488. Profile Description: Protein of unknown function (DUF1450). hypothetical protein; Provisional |
| Pubmed ID | 34061833 |
| Domain | CDD:416296 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | Q8CT91 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 116
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 840738 | 840974 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 912500 | 912736 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 860614 | 860850 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 2003187 | 2003423 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 5 | 731031 | 731267 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 6 | 1217989 | 1218225 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 7 | 1909780 | 1910016 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 8 | 2149753 | 2149989 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 9 | 961677 | 961913 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 10 | 1906591 | 1906827 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 11 | 856118 | 856354 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 12 | 1753942 | 1754178 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 13 | 530477 | 530713 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 14 | 1982648 | 1982884 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 15 | 1373869 | 1374105 | + | NZ_CP027770.1 | Staphylococcus felis |
| 16 | 1863180 | 1863416 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 17 | 637951 | 638187 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 18 | 345356 | 345592 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 19 | 1816868 | 1817104 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 20 | 562203 | 562439 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 21 | 1900159 | 1900395 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 22 | 610059 | 610304 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 23 | 2065512 | 2065757 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 24 | 2403007 | 2403255 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 25 | 1876594 | 1876839 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 26 | 198715 | 198960 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 27 | 403095 | 403340 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 28 | 781731 | 781967 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 29 | 2102516 | 2102761 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 30 | 1015520 | 1015756 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 31 | 1427511 | 1427756 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 32 | 712736 | 712972 | + | NZ_CP047361.1 | Macrococcus canis |
| 33 | 1956998 | 1957243 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 34 | 1167568 | 1167804 | - | NZ_CP016538.2 | Planococcus maritimus |
| 35 | 1178293 | 1178529 | - | NZ_CP059540.1 | Planococcus maritimus |
| 36 | 2688348 | 2688584 | - | NZ_CP012024.1 | Bacillus smithii |
| 37 | 1203234 | 1203470 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 38 | 592434 | 592670 | + | NZ_CP013661.2 | Planococcus kocurii |
| 39 | 1177882 | 1178118 | - | NZ_CP019401.1 | Planococcus faecalis |
| 40 | 2430682 | 2430918 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 41 | 1117694 | 1117930 | - | NZ_CP016540.2 | Planococcus versutus |
| 42 | 921466 | 921702 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 43 | 3379884 | 3380120 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 44 | 1019544 | 1019780 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 45 | 982859 | 983095 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 46 | 3254324 | 3254560 | - | NZ_LS483476.1 | Lederbergia lentus |
| 47 | 1109874 | 1110110 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 48 | 665855 | 666091 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 49 | 3103236 | 3103472 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 50 | 2403439 | 2403675 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 51 | 263619 | 263855 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 52 | 3839872 | 3840111 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 53 | 3216114 | 3216350 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 54 | 1246988 | 1247224 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 55 | 4710791 | 4711030 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 56 | 917254 | 917490 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 57 | 3692426 | 3692662 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 58 | 2928012 | 2928248 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 59 | 1069579 | 1069815 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 60 | 1152263 | 1152499 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 61 | 877779 | 878015 | + | NZ_CP011937.1 | Bacillus velezensis |
| 62 | 3107552 | 3107788 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 63 | 2864025 | 2864255 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 64 | 3175401 | 3175637 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 65 | 3114422 | 3114658 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 66 | 3172540 | 3172776 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 67 | 3308368 | 3308604 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 68 | 3093303 | 3093539 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 69 | 2955963 | 2956199 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 70 | 1957679 | 1957915 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 71 | 1554923 | 1555153 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 72 | 1071198 | 1071434 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 73 | 2288439 | 2288672 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 74 | 1058832 | 1059068 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 75 | 3662275 | 3662511 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 76 | 726197 | 726433 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 77 | 811680 | 811913 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 78 | 3977405 | 3977608 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 79 | 3036631 | 3036867 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 80 | 2314719 | 2314958 | - | NZ_LR134483.1 | Listeria grayi |
| 81 | 2400801 | 2401040 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 82 | 3609064 | 3609303 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 83 | 2179984 | 2180220 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 84 | 2367350 | 2367583 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 85 | 2494330 | 2494563 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 86 | 3527368 | 3527604 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 87 | 3653710 | 3653946 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 88 | 2467388 | 2467621 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 89 | 1882627 | 1882863 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 90 | 2739586 | 2739825 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 91 | 3165246 | 3165506 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 92 | 309536 | 309775 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 93 | 3646021 | 3646257 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 94 | 2384196 | 2384429 | - | NZ_LT906444.1 | Listeria welshimeri |
| 95 | 1051150 | 1051371 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 96 | 3250463 | 3250699 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 97 | 3475591 | 3475827 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 98 | 2894711 | 2894905 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 99 | 303506 | 303727 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 100 | 2316644 | 2316883 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 101 | 1202427 | 1202648 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 102 | 968185 | 968445 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 103 | 1995148 | 1995402 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 104 | 780973 | 781209 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 105 | 1003844 | 1004107 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 106 | 5736763 | 5737017 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 107 | 2559051 | 2559305 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 108 | 5773103 | 5773357 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 109 | 1873713 | 1873949 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 110 | 1781471 | 1781707 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 111 | 5080771 | 5081025 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 112 | 24439 | 24699 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 113 | 4891925 | 4892179 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 114 | 4654282 | 4654536 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 115 | 309745 | 309999 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 116 | 1046701 | 1046964 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 117 | 1527530 | 1527793 | + | NZ_CP026363.1 | Brevibacillus agri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01106.19 | 0.92 | 107 | 1883.0 | opposite-strand | NifU-like domain |
| 2 | PF07315.13 | 0.81 | 94 | 1457 | same-strand | Protein of unknown function (DUF1462) |
| 3 | PF07992.16 | 0.97 | 113 | 465.5 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 4 | PF00070.29 | 0.97 | 113 | 465.5 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 5 | PF01521.22 | 0.92 | 107 | 1664.0 | same-strand | Iron-sulphur cluster biosynthesis |
++ More..