Result : EXP02271
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02271 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1338596 |
| Right | 1338829 |
| Strand | + |
| Nucleotide Sequence | ATGATTGCAAACGAAAACATCCAAGACAAAGCACTAGAGAATTTTAAAGCAAACCAAACTGAAGTAACTGTATTCTTTCTAAACGGTTTCCAAATGAAAGGTGTTATTGAAGAATACGACAAGTATGTCGTAAGCTTAAATTCTCAAGGCAAACAACACTTGATTTACAAACATGCGATCAGCACTTATACAGTAGAAACTGAAGGTCAAGCATCTACTGAAAGTGAAGAATAA |
| Sequence | MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTVETEGQASTESEE |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00259. Profile Description: Sm and related proteins. This SM domain is found in Ataxin-2. |
| Pubmed ID | 34061833 |
| Domain | CDD:412267 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 46
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1238640 | 1238873 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1310092 | 1310325 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1267915 | 1268154 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1585539 | 1585778 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 5 | 1790522 | 1790761 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 6 | 621411 | 621650 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 7 | 14836 | 15078 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 8 | 970074 | 970316 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 9 | 475529 | 475768 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 10 | 1648667 | 1648906 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 11 | 1526214 | 1526450 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 12 | 2455995 | 2456231 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 13 | 1177376 | 1177594 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 14 | 1619242 | 1619466 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 15 | 1524210 | 1524434 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 16 | 1382093 | 1382308 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 17 | 832817 | 833029 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 18 | 270839 | 271054 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 19 | 1226933 | 1227127 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 20 | 1790670 | 1790882 | + | NZ_CP027770.1 | Staphylococcus felis |
| 21 | 1684756 | 1684971 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 22 | 1409281 | 1409496 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 23 | 2308358 | 2308564 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 24 | 1098212 | 1098418 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 25 | 1548088 | 1548297 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 26 | 943431 | 943634 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 27 | 1443594 | 1443815 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 28 | 1352166 | 1352396 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 29 | 957258 | 957464 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 30 | 1603659 | 1603865 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 31 | 1091588 | 1091785 | + | NZ_CP047361.1 | Macrococcus canis |
| 32 | 892302 | 892496 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 33 | 3137463 | 3137687 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 34 | 810524 | 810751 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 35 | 1946456 | 1946680 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 36 | 757553 | 757777 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 37 | 1199089 | 1199286 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 38 | 2652317 | 2652541 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 39 | 2031377 | 2031604 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 40 | 1336948 | 1337175 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 41 | 425914 | 426141 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 42 | 2645782 | 2646009 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 43 | 786678 | 786905 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 44 | 4336100 | 4336324 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 45 | 3875270 | 3875494 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 46 | 3600366 | 3600599 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00230.22 | 0.61 | 28 | 5600.5 | same-strand | Major intrinsic protein |
| 2 | PF00370.23 | 0.72 | 33 | 3969 | same-strand | FGGY family of carbohydrate kinases, N-terminal domain |
| 3 | PF02782.18 | 0.7 | 32 | 3966.5 | same-strand | FGGY family of carbohydrate kinases, C-terminal domain |
| 4 | PF01266.26 | 0.74 | 34 | 2134.5 | same-strand | FAD dependent oxidoreductase |
| 5 | PF16901.7 | 0.74 | 34 | 2134.5 | same-strand | C-terminal domain of alpha-glycerophosphate oxidase |
| 6 | PF12146.10 | 0.78 | 36 | 957.0 | same-strand | Serine aminopeptidase, S33 |
| 7 | PF01715.19 | 1.0 | 46 | 2.0 | same-strand | IPP transferase |
| 8 | PF00255.21 | 0.72 | 33 | 222 | opposite-strand | Glutathione peroxidase |
| 9 | PF16360.7 | 0.74 | 34 | 808.0 | same-strand | GTP-binding GTPase Middle Region |
| 10 | PF13167.8 | 0.76 | 35 | 808 | same-strand | GTP-binding GTPase N-terminal |
| 11 | PF01926.25 | 0.76 | 35 | 808 | same-strand | 50S ribosome-binding GTPase |
| 12 | PF06838.13 | 0.78 | 36 | 2062.5 | same-strand | Methionine gamma-lyase |
| 13 | PF13411.8 | 0.67 | 31 | 3548 | same-strand | MerR HTH family regulatory protein |
| 14 | PF00376.25 | 0.67 | 31 | 3548 | same-strand | MerR family regulatory protein |
| 15 | PF00120.26 | 0.63 | 29 | 3872 | same-strand | Glutamine synthetase, catalytic domain |
| 16 | PF03951.21 | 0.63 | 29 | 3872 | same-strand | Glutamine synthetase, beta-Grasp domain |
++ More..