Result : EXP02268
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02268 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 327111 |
| Right | 327332 |
| Strand | + |
| Nucleotide Sequence | ATGAAGCAGACTGTAACTTATATCATTCGTCATAGGGATATGCCAATTTATATAACTAACAAACCAACTGATAACAATTCAGATATTAGTTACTCCACAAATAGAAATAGAGCTAGGGAGTTTAACGGTATGGAAGAAGCGAGTATCAATATGGATTATCACAAAGCAATCAAGAAAACAGTGACAGAAACTATTGAGTACGAGGAGGTAGAACATGACTGA |
| Sequence | MKQTVTYIIRHRDMPIYITNKPTDNNSDISYSTNRNRAREFNGMEEASINMDYHKAIKKTVTETIEYEEVEHD |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam10656. Profile Description: Hypothetical protein of unknown function (DUF2483). This is a family of proteins found in bacteriophage particularly of the SA bacteriophages 11, Mu50B, family, homologous to phi-ETA orf16. |
| Pubmed ID | 34061833 |
| Domain | CDD:371183 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2067303 | 2067524 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 526601 | 526783 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 3 | 2302774 | 2302998 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 4 | 821448 | 821669 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 5 | 296451 | 296672 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 6 | 2010944 | 2011168 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 7 | 901558 | 901779 | + | NZ_CP033460.1 | Staphylococcus debuckii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP018199.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16784.7 | 1.0 | 7 | 1062 | same-strand | Putative HNHc nuclease |
| 2 | PF00436.27 | 0.71 | 5 | 612 | same-strand | Single-strand binding protein family |
++ More..