Result : EXP02267
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02267 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1223523 |
| Right | 1223735 |
| Strand | + |
| Nucleotide Sequence | ATGAATGACAAAACATCTAATGATTTATATGGGAAGATAAAACATTGTAACGAATTTATCAATCATTCAAATGATTCCAATCTATCTAGTAGTCACGATGTCGACGAAAGTTCAACGAAGCAAAAACATATAAAAAATAAAACAACTATAGATCATAATGATGATTTATTTAAACATGTAAAGGATATATTACGTAAACAAGAACAAATTTAA |
| Sequence | MNDKTSNDLYGKIKHCNEFINHSNDSNLSSSHDVDESSTKQKHIKNKTTIDHNDDLFKHVKDILRKQEQI |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1123566 | 1123778 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1193534 | 1193740 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1149389 | 1149592 | + | NZ_LT906460.1 | Staphylococcus simiae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01979.22 | 1.0 | 3 | 5711 | same-strand | Amidohydrolase family |
| 2 | PF12890.9 | 1.0 | 3 | 5711 | same-strand | Dihydro-orotase-like |
| 3 | PF00988.24 | 1.0 | 3 | 4609 | same-strand | Carbamoyl-phosphate synthase small chain, CPSase domain |
| 4 | PF00117.30 | 1.0 | 3 | 4609 | same-strand | Glutamine amidotransferase class-I |
| 5 | PF02786.19 | 1.0 | 3 | 1443 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 6 | PF02787.21 | 1.0 | 3 | 1443 | same-strand | Carbamoyl-phosphate synthetase large chain, oligomerisation domain |
| 7 | PF02142.24 | 1.0 | 3 | 1443 | same-strand | MGS-like domain |
| 8 | PF02655.16 | 1.0 | 3 | 1443 | same-strand | ATP-grasp domain |
| 9 | PF02222.24 | 1.0 | 3 | 1443 | same-strand | ATP-grasp domain |
| 10 | PF15632.8 | 1.0 | 3 | 1443 | same-strand | ATP-grasp in the biosynthetic pathway with Ter operon |
| 11 | PF01071.21 | 1.0 | 3 | 1443 | same-strand | Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain |
| 12 | PF13535.8 | 1.0 | 3 | 1443 | same-strand | ATP-grasp domain |
| 13 | PF00215.26 | 1.0 | 3 | 641 | same-strand | Orotidine 5'-phosphate decarboxylase / HUMPS family |
| 14 | PF06983.15 | 1.0 | 3 | 437 | same-strand | 3-demethylubiquinone-9 3-methyltransferase |
| 15 | PF05833.13 | 1.0 | 3 | 1045 | opposite-strand | NFACT N-terminal and middle domains |
| 16 | PF05670.15 | 1.0 | 3 | 1045 | opposite-strand | NFACT protein RNA binding domain |
| 17 | PF00625.23 | 1.0 | 3 | 3014 | same-strand | Guanylate kinase |
| 18 | PF01192.24 | 1.0 | 3 | 3637 | same-strand | RNA polymerase Rpb6 |
| 19 | PF04127.17 | 1.0 | 3 | 4130 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 20 | PF02441.21 | 1.0 | 3 | 4130 | same-strand | Flavoprotein |
++ More..