| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02263 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 860790 |
| Right | 860993 |
| Strand | + |
| Nucleotide Sequence | ATGACGTTTTACAATTTCATCATGGGTTTTCAAAATGATAACACACCATTTGGTATATTGGCCGAACACGTTAGTGAAGATAAAGCATTCCCTCGATTAGAAGAAAGACACCAAGTAATTAGAGCATATGTGATGTCTAATTACACAGATCATCAATTAATTGAAACTACAAATAGAGCTATTAGCTTATATATGGCAAATTAA |
| Sequence | MTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRAISLYMAN |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
| Pubmed ID | 34061833 |
| Domain | CDD:416295 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 67 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 804000 | 804203 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 873564 | 873767 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 822350 | 822553 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 574067 | 574270 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 5 | 2024513 | 2024716 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 1911982 | 1912185 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 7 | 2120147 | 2120350 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 8 | 164347 | 164550 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 9 | 433192 | 433395 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 10 | 1992029 | 1992232 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 11 | 922878 | 923081 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 12 | 1939261 | 1939470 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00300.24 | 0.92 | 11 | 452 | same-strand | Histidine phosphatase superfamily (branch 1) |
| 2 | PF13420.9 | 1.0 | 12 | 1881.0 | opposite-strand | Acetyltransferase (GNAT) domain |
| 3 | PF02566.21 | 0.92 | 11 | 2760 | opposite-strand | OsmC-like protein |