Result : B3WC79
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | D-alanyl carrier protein (DCP) (D-alanine--poly(phosphoribitol) ligase subunit 2) |
| NCBI Accession ID | FM177140.1 |
| Organism | Lactobacillus casei (strain BL23) |
| Left | 854186 |
| Right | 854431 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGACGAAGCAATTAAAAATGGTGTTCTAGATATTTTGGCAGATTTAACCGGTTCTGATGATGTGAAGACAAATTTGGATCTGAATCTGTTTGAAACCGGCTTGTTAGATTCAATGGGGACGGTACAACTGTTGTTGGAACTGCAAAGCCAGTTCGGCGTAGAAGCACCTGTTTCTGAATTTGATCGTAGTCAATGGGATACCCCTAACAAAATCATCGCAAAGGTCGAACAAGCACAATGA |
| Sequence | MADEAIKNGVLDILADLTGSDDVKTNLDLNLFETGLLDSMGTVQLLLELQSQFGVEAPVSEFDRSQWDTPNKIIAKVEQAQ |
| Source of smORF | Swiss-Prot |
| Function | Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall. {ECO:0000255|HAMAP-Rule:MF_00565}. |
| Pubmed ID | |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | B3WC79 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 86
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 744144 | 744389 | + | NC_014334.2 | Lacticaseibacillus paracasei |
| 2 | 605092 | 605337 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 3 | 714249 | 714494 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 4 | 809426 | 809656 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 5 | 1855998 | 1856234 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 6 | 872908 | 873144 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 7 | 874492 | 874719 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 8 | 146317 | 146550 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 9 | 1333151 | 1333351 | - | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 10 | 617731 | 617964 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 11 | 1557624 | 1557827 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 12 | 1187045 | 1187257 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 13 | 244439 | 244651 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 14 | 1802481 | 1802720 | - | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 15 | 1804524 | 1804763 | - | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 16 | 1845396 | 1845635 | - | NZ_AP018549.1 | Lactobacillus paragasseri |
| 17 | 2019576 | 2019815 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 18 | 2114026 | 2114235 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 19 | 1980772 | 1981011 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 20 | 1932426 | 1932665 | - | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 21 | 1550880 | 1551116 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 22 | 3672825 | 3673061 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 23 | 1896464 | 1896697 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 24 | 2526133 | 2526369 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 25 | 197642 | 197845 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 26 | 211690 | 211929 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 27 | 2753207 | 2753440 | - | NZ_CP023011.2 | Enterococcus hirae |
| 28 | 1203791 | 1204027 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 29 | 112399 | 112602 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 30 | 1813384 | 1813623 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 31 | 1972526 | 1972765 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 32 | 1734462 | 1734674 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 33 | 1826146 | 1826361 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 34 | 2209664 | 2209879 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 35 | 2142796 | 2143011 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 36 | 1618410 | 1618649 | - | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 37 | 358498 | 358734 | + | NZ_CP042410.1 | Leuconostoc citreum |
| 38 | 680048 | 680254 | + | NC_018631.1 | Leuconostoc gelidum JB7 |
| 39 | 1719290 | 1719526 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 40 | 1663458 | 1663694 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 41 | 1458322 | 1458558 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 42 | 907875 | 908078 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 43 | 1649762 | 1650001 | - | NZ_CP029476.1 | Lactobacillus apis |
| 44 | 1356112 | 1356345 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 45 | 470835 | 471041 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 46 | 624918 | 625151 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 47 | 2060228 | 2060464 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 48 | 1476066 | 1476302 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 49 | 293190 | 293426 | + | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 50 | 1875666 | 1875899 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 51 | 1164152 | 1164361 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 52 | 2659739 | 2659942 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 53 | 1758568 | 1758798 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 54 | 455287 | 455523 | + | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 55 | 245034 | 245270 | - | NZ_CP011937.1 | Bacillus velezensis |
| 56 | 3795093 | 3795329 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 57 | 322667 | 322900 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 58 | 442138 | 442350 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 59 | 1952429 | 1952659 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 60 | 2341374 | 2341589 | - | NZ_LR134483.1 | Listeria grayi |
| 61 | 921316 | 921534 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 62 | 338671 | 338889 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 63 | 264829 | 265062 | + | NZ_CP014324.1 | Oenococcus oeni |
| 64 | 883598 | 883831 | + | NZ_CP029684.2 | Oenococcus sicerae |
| 65 | 882414 | 882647 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 66 | 1689401 | 1689637 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 67 | 1951592 | 1951828 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 68 | 2302351 | 2302587 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 69 | 1987976 | 1988209 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 70 | 732844 | 733077 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 71 | 2045677 | 2045910 | - | NZ_CP065211.1 | Enterococcus lactis |
| 72 | 286785 | 287024 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 73 | 1880697 | 1880903 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 74 | 2437340 | 2437576 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 75 | 303315 | 303554 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 76 | 1796055 | 1796303 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 77 | 2783199 | 2783435 | + | NZ_CP043404.1 | Bacillus safensis |
| 78 | 270293 | 270529 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 79 | 2521390 | 2521626 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 80 | 2870908 | 2871144 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 81 | 1603374 | 1603613 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 82 | 1517583 | 1517822 | + | NZ_CP043405.1 | Streptococcus ratti |
| 83 | 602034 | 602273 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 84 | 1222182 | 1222388 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 85 | 1971646 | 1971882 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 86 | 234234 | 234431 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 87 | 1205266 | 1205472 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 88 | 1966238 | 1966477 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 89 | 1400608 | 1400808 | - | NZ_AP018400.1 | Streptococcus ruminantium |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014334.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12459.10 | 0.84 | 72 | 2781.5 | same-strand | D-Ala-teichoic acid biosynthesis protein |
| 2 | PF00501.30 | 1.0 | 86 | 1247.5 | same-strand | AMP-binding enzyme |
| 3 | PF13193.8 | 0.83 | 71 | 1241 | same-strand | AMP-binding enzyme C-terminal domain |
| 4 | PF04914.14 | 0.99 | 85 | 0 | same-strand | DltD protein |
++ More..