Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02259 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 1114521 |
Right | 1114709 |
Strand | + |
Nucleotide Sequence | ATGGGGTGTTTAGTGGTGGTTAAAGAAATTTTGAGACTATTATTCTTACTAGCGATGTATGAGTTAGGTAAGTATGTAACTGAGCAAGTATATATTATGATGACGGCTAATGATGATGTAGAGGCGCCGATTTACTTCGCAAAGTTGAGCGATCAGTCTGATTTGATGAGGGCGGAGGTGTCAGAGTAG |
Sequence | MGCLVVVKEILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPIYFAKLSDQSDLMRAEVSE |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of pfam06116. Profile Description: Transcriptional activator RinB. This family consists of several Staphylococcus aureus bacteriophage RinB proteins and related sequences from their host. The int gene of staphylococcal bacteriophage phi 11 is the only viral gene responsible for the integrative recombination of phi 11. rinA and rinB, are both required to activate expression of the int gene. |
Pubmed ID | 34061833 |
Domain | CDD:283718 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 62 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1951266 | 1951454 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 1493789 | 1493956 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
3 | 2059299 | 2059457 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
4 | 2056108 | 2056275 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
5 | 723310 | 723486 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03592.18 | 1.0 | 2 | 849.0 | same-strand | Terminase small subunit |
2 | PF07129.13 | 1.0 | 2 | -7 | same-strand | Protein of unknown function (DUF1381) |
3 | PF01844.25 | 1.0 | 2 | 1399.0 | same-strand | HNH endonuclease |