Result : EXP02258
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02258 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2130379 |
| Right | 2130561 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATAACTAATTGCAAAATAAAAAGAGAAACTGTAATATACGAAGTTTTAACTAGTGGTAATCAACCATTCACTTATGAGTTACCTAAAGATTTATCGTCACATAATGCGCGTAAATACTTGGAATTTATTTCACAAAAATTAGATGGCGATAAGTTAACCAAAGAAGATTCATTATGA |
| Sequence | MKITNCKIKRETVIYEVLTSGNQPFTYELPKDLSSHNARKYLEFISQKLDGDKLTKEDSL |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1506190 | 1506372 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1964181 | 1964348 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 3 | 2072469 | 2072636 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 4 | 897027 | 897209 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 5 | 1591058 | 1591222 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033460.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 0.67 | 2 | 1215.0 | both-strands | Helix-turn-helix |
| 2 | PF12844.9 | 0.67 | 2 | 931 | opposite-strand | Helix-turn-helix domain |
| 3 | PF13560.8 | 0.67 | 2 | 1758 | opposite-strand | Helix-turn-helix domain |
| 4 | PF00717.25 | 0.67 | 2 | 570.0 | same-strand | Peptidase S24-like |
| 5 | PF13443.8 | 0.67 | 2 | 1628.5 | both-strands | Cro/C1-type HTH DNA-binding domain |
| 6 | PF00589.24 | 0.67 | 2 | 935.0 | same-strand | Phage integrase family |
| 7 | PF03374.16 | 0.67 | 2 | 1825.0 | opposite-strand | Phage antirepressor protein KilAC domain |
| 8 | PF14657.8 | 0.67 | 2 | 1242.5 | same-strand | Arm DNA-binding domain |
| 9 | PF14659.8 | 0.67 | 2 | 950 | same-strand | Phage integrase, N-terminal SAM-like domain |
| 10 | PF13102.8 | 0.67 | 2 | 925.5 | same-strand | Phage integrase SAM-like domain |
++ More..