Result : B3W9Z1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Nucleoid-associated protein LCABL_24440 |
| NCBI Accession ID | FM177140.1 |
| Organism | Lactobacillus casei (strain BL23) |
| Left | 2396901 |
| Right | 2397200 |
| Strand | - |
| Nucleotide Sequence | ATGGGTAATATGCAAGGCATGATGAAGCAGATGCAGAAAATGCAAAAGGAAATGCAGGCAGCACAAAGGGAACTGTATGCAACGGAATTTGAAGGCAAGTCAGCTTCCGATATGGTCACCGTTAAGTTTACCGGTGAAAAGATCATGAAAGACATTCAAATCAAACCAGAAGCCATCGATCCAGACGATCCGGACATGCTCCAAGACCTGATTATAGAAGCGGTTAATCAAGCCATGGGAACCATTGATAAGGAAACTCAAGATAAGATGGGCAAGTATACACGCGGATTGCCAATGTAA |
| Sequence | MGNMQGMMKQMQKMQKEMQAAQRELYATEFEGKSASDMVTVKFTGEKIMKDIQIKPEAIDPDDPDMLQDLIIEAVNQAMGTIDKETQDKMGKYTRGLPM |
| Source of smORF | Swiss-Prot |
| Function | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}. |
| Pubmed ID | |
| Domain | CDD:412410 |
| Functional Category | DNA-binding |
| Uniprot ID | B3W9Z1 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 167
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2196096 | 2196395 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 2 | 2165272 | 2165571 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 3 | 2196818 | 2197117 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 4 | 1099277 | 1099528 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 5 | 311557 | 311856 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 6 | 877049 | 877351 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| 7 | 1455308 | 1455610 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 8 | 1412433 | 1412735 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 9 | 3645015 | 3645317 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 10 | 1918877 | 1919179 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 11 | 1210708 | 1210959 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 12 | 1453869 | 1454171 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 13 | 608953 | 609252 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 14 | 2003692 | 2003994 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 15 | 1625441 | 1625743 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 16 | 2062703 | 2063005 | - | NZ_CP065211.1 | Enterococcus lactis |
| 17 | 501918 | 502220 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 18 | 425135 | 425377 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 19 | 99235 | 99534 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 20 | 290572 | 290871 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 21 | 1342292 | 1342591 | + | NZ_CP023011.2 | Enterococcus hirae |
| 22 | 1814528 | 1814830 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 23 | 2253575 | 2253874 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 24 | 438332 | 438577 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 25 | 1191158 | 1191403 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 26 | 179064 | 179306 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 27 | 326350 | 326646 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 28 | 1451955 | 1452254 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 29 | 1528597 | 1528899 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 30 | 366152 | 366460 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 31 | 270557 | 270859 | + | NZ_CP014164.1 | Aerococcus viridans |
| 32 | 696575 | 696883 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 33 | 452495 | 452740 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 34 | 1022832 | 1023083 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 35 | 1702396 | 1702698 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 36 | 1913622 | 1913924 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 37 | 414244 | 414489 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 38 | 856243 | 856545 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 39 | 777761 | 778045 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 40 | 436830 | 437075 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 41 | 389354 | 389599 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 42 | 398650 | 398895 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 43 | 900644 | 900946 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 44 | 393434 | 393679 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 45 | 456041 | 456286 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 46 | 1140672 | 1140971 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 47 | 1395736 | 1396038 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 48 | 451891 | 452148 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 49 | 1480915 | 1481160 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 50 | 1440930 | 1441181 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 51 | 1742450 | 1742752 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 52 | 317205 | 317450 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 53 | 394075 | 394320 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 54 | 1405067 | 1405312 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 55 | 1158325 | 1158570 | - | NZ_CP029476.1 | Lactobacillus apis |
| 56 | 1258673 | 1258972 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 57 | 2064240 | 2064503 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 58 | 374524 | 374769 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 59 | 563221 | 563478 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 60 | 10176 | 10487 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 61 | 547184 | 547429 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 62 | 1285773 | 1286024 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 63 | 354890 | 355135 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 64 | 3200531 | 3200842 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 65 | 1317636 | 1317881 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 66 | 1397136 | 1397381 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 67 | 1338651 | 1338908 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 68 | 474211 | 474513 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 69 | 3146363 | 3146611 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 70 | 29030 | 29341 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 71 | 2721886 | 2722197 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 72 | 243792 | 244103 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 73 | 2368558 | 2368869 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 74 | 1600140 | 1600451 | + | NZ_CP021434.1 | Tumebacillus avium |
| 75 | 226883 | 227179 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 76 | 2045785 | 2046096 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 77 | 132589 | 132900 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 78 | 132598 | 132909 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 79 | 1985820 | 1986083 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 80 | 1755837 | 1756148 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 81 | 387507 | 387755 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 82 | 1761762 | 1762010 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 83 | 126159 | 126422 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 84 | 735386 | 735682 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 85 | 1045414 | 1045671 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 86 | 727443 | 727691 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 87 | 1753714 | 1754016 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 88 | 4035427 | 4035720 | - | NZ_CP019870.1 | Clostridioides difficile |
| 89 | 980118 | 980366 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 90 | 488414 | 488716 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 91 | 2611557 | 2611859 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 92 | 1299097 | 1299399 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 93 | 2127908 | 2128156 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 94 | 44052 | 44363 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 95 | 1614011 | 1614268 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 96 | 1991567 | 1991824 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 97 | 1918671 | 1918928 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 98 | 936642 | 936944 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 99 | 1481222 | 1481479 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 100 | 28205 | 28516 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 101 | 164327 | 164638 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 102 | 1939069 | 1939326 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 103 | 28149 | 28460 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 104 | 13777 | 14088 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 105 | 28541 | 28852 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 106 | 1600699 | 1601010 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 107 | 589341 | 589652 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 108 | 1517644 | 1517955 | - | NZ_CP043404.1 | Bacillus safensis |
| 109 | 36830 | 37141 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 110 | 64687 | 64944 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 111 | 32683 | 32994 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 112 | 2777497 | 2777805 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 113 | 32816 | 33127 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 114 | 1017520 | 1017771 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 115 | 16861 | 17121 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 116 | 2340549 | 2340806 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 117 | 3901475 | 3901786 | - | NZ_CP011937.1 | Bacillus velezensis |
| 118 | 2267689 | 2267946 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 119 | 2475056 | 2475313 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 120 | 301912 | 302169 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 121 | 1661478 | 1661735 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 122 | 2267808 | 2268065 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 123 | 59407 | 59718 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 124 | 26162 | 26476 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 125 | 29761 | 30072 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 126 | 2685495 | 2685803 | - | NZ_LT906444.1 | Listeria welshimeri |
| 127 | 2687339 | 2687647 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 128 | 2841888 | 2842196 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 129 | 2678153 | 2678461 | - | NZ_LR134483.1 | Listeria grayi |
| 130 | 294256 | 294516 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 131 | 1980817 | 1981128 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 132 | 4161794 | 4162105 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 133 | 1167958 | 1168218 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 134 | 274062 | 274322 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 135 | 1043928 | 1044185 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 136 | 158712 | 158969 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 137 | 458924 | 459181 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 138 | 447107 | 447364 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 139 | 2351444 | 2351701 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 140 | 1298464 | 1298721 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 141 | 761042 | 761299 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 142 | 29916 | 30176 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 143 | 2112855 | 2113157 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 144 | 464086 | 464343 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 145 | 2341539 | 2341796 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 146 | 2475050 | 2475307 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 147 | 250387 | 250644 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 148 | 2723861 | 2724172 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 149 | 28906 | 29166 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 150 | 49516 | 49770 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 151 | 29038 | 29292 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 152 | 2297374 | 2297682 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 153 | 1640963 | 1641220 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 154 | 27183 | 27437 | + | NZ_CP016540.2 | Planococcus versutus |
| 155 | 2469599 | 2469889 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 156 | 2543824 | 2544114 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 157 | 28006 | 28314 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 158 | 2526789 | 2527046 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 159 | 93524 | 93781 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 160 | 27803 | 28063 | + | NZ_CP016538.2 | Planococcus maritimus |
| 161 | 27462 | 27722 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 162 | 27706 | 27966 | + | NZ_CP059540.1 | Planococcus maritimus |
| 163 | 3215704 | 3215964 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 164 | 31324 | 31635 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 165 | 1732614 | 1732874 | - | NZ_CP013661.2 | Planococcus kocurii |
| 166 | 29999 | 30259 | + | NZ_CP019401.1 | Planococcus faecalis |
| 167 | 29196 | 29507 | + | NZ_CP012024.1 | Bacillus smithii |
| 168 | 37541 | 37801 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 169 | 1176915 | 1177217 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014334.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13177.8 | 0.96 | 160 | 103 | same-strand | DNA polymerase III, delta subunit |
| 2 | PF00004.31 | 0.96 | 160 | 81 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 3 | PF02223.19 | 0.72 | 121 | 1196 | same-strand | Thymidylate kinase |
| 4 | PF13662.8 | 0.95 | 159 | 15 | same-strand | Toprim domain |
| 5 | PF02132.17 | 0.95 | 159 | 15 | same-strand | RecR protein |
| 6 | PF01751.24 | 0.94 | 157 | 15 | same-strand | Toprim domain |
| 7 | PF12169.10 | 0.89 | 148 | 50.0 | same-strand | DNA polymerase III subunits gamma and tau domain III |
| 8 | PF14437.8 | 0.66 | 110 | 2207 | same-strand | MafB19-like deaminase |
| 9 | PF00383.25 | 0.66 | 110 | 2207 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
++ More..