Result : A1A087
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | AP009256.1 |
| Organism | Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) |
| Left | 431709 |
| Right | 431894 |
| Strand | + |
| Nucleotide Sequence | GTGATGACTAACCTGAACATCAAGCTGCACCACGGTCTGGTGAACTCCACTCCGAAGCAGCGTGCTGCGGCTCAGACTCTGGGCCTGAACAAGATCGGCAAGACCGTGACTCGTGAGGATACTCCGGCCCTTCGTGGCCAGCTGCAGGTCCTCCGTCACCTGATCACCGTCGAGGAGGCTGACTGA |
| Sequence | MMTNLNIKLHHGLVNSTPKQRAAAQTLGLNKIGKTVTREDTPALRGQLQVLRHLITVEEAD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A1A087 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 38
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 441167 | 441352 | + | NZ_CP028341.1 | Bifidobacterium adolescentis |
| 2 | 536945 | 537130 | + | NZ_AP012326.1 | Bifidobacterium dentium JCM 1195 = DSM 20436 |
| 3 | 408092 | 408277 | + | NZ_AP012325.1 | Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043 |
| 4 | 448370 | 448555 | + | NZ_CP025199.1 | Bifidobacterium pseudocatenulatum |
| 5 | 1682748 | 1682933 | - | NZ_AP012322.1 | Bifidobacterium angulatum DSM 20098 = JCM 7096 |
| 6 | 621057 | 621242 | + | NZ_AP012331.1 | Bifidobacterium scardovii JCM 12489 = DSM 13734 |
| 7 | 1988034 | 1988219 | - | NZ_CP026999.1 | Bifidobacterium longum |
| 8 | 1168559 | 1168741 | - | NZ_CP062938.1 | Bifidobacterium eulemuris |
| 9 | 1689800 | 1689982 | + | NZ_CP062948.1 | Bifidobacterium lemurum |
| 10 | 1896028 | 1896213 | - | NZ_CP006712.1 | Bifidobacterium breve JCM 7017 |
| 11 | 471360 | 471545 | + | NZ_CP022544.1 | Bifidobacterium pseudolongum |
| 12 | 1157123 | 1157308 | + | NZ_CP018044.1 | Bifidobacterium choerinum |
| 13 | 378559 | 378744 | + | NZ_CP011546.1 | Corynebacterium uterequi |
| 14 | 1391015 | 1391200 | - | NZ_CP006018.1 | Bifidobacterium indicum LMG 11587 = DSM 20214 |
| 15 | 1428143 | 1428328 | - | NZ_CP007287.1 | Bifidobacterium coryneforme |
| 16 | 527796 | 527981 | + | NZ_CP011542.1 | Corynebacterium mustelae |
| 17 | 387380 | 387565 | + | NC_017301.2 | Corynebacterium pseudotuberculosis C231 |
| 18 | 1926557 | 1926742 | + | NZ_LT906443.1 | Corynebacterium ulcerans |
| 19 | 449485 | 449670 | + | NZ_CP011545.1 | Corynebacterium testudinoris |
| 20 | 2069192 | 2069371 | - | NZ_LT906473.1 | Corynebacterium cystitidis |
| 21 | 471010 | 471177 | - | NZ_CP038157.1 | Corynebacterium sanguinis |
| 22 | 556362 | 556547 | + | NC_020302.1 | Corynebacterium halotolerans YIM 70093 = DSM 44683 |
| 23 | 639863 | 640042 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 24 | 385562 | 385747 | + | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 25 | 501209 | 501394 | + | NZ_LT906467.1 | Corynebacterium imitans |
| 26 | 766462 | 766647 | - | NZ_CP068161.1 | Corynebacterium propinquum |
| 27 | 380800 | 380952 | + | NZ_CP011311.1 | Corynebacterium camporealensis |
| 28 | 1109050 | 1109202 | - | NZ_CP014635.1 | Corynebacterium simulans |
| 29 | 402476 | 402628 | + | NZ_CP019688.1 | Corynebacterium glaucum |
| 30 | 486696 | 486848 | + | NZ_CP010827.1 | Corynebacterium singulare |
| 31 | 5494139 | 5494321 | + | NZ_CP033972.1 | Gordonia insulae |
| 32 | 323342 | 323509 | + | NZ_CP009215.1 | Corynebacterium ureicelerivorans |
| 33 | 3295107 | 3295286 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 34 | 3911220 | 3911402 | - | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 35 | 3912234 | 3912416 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 36 | 2272350 | 2272502 | - | NZ_CP009249.1 | Corynebacterium phocae |
| 37 | 3617892 | 3618074 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 38 | 3423893 | 3424075 | - | NZ_CP027433.1 | Gordonia iterans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028341.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00410.21 | 1.0 | 38 | 1655.0 | same-strand | Ribosomal protein S8 |
| 2 | PF00347.25 | 1.0 | 38 | 1100.5 | same-strand | Ribosomal protein L6 |
| 3 | PF00861.24 | 1.0 | 38 | 714.0 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 4 | PF03719.17 | 1.0 | 38 | 4.0 | same-strand | Ribosomal protein S5, C-terminal domain |
| 5 | PF00333.22 | 1.0 | 38 | 4.0 | same-strand | Ribosomal protein S5, N-terminal domain |
| 6 | PF00828.21 | 1.0 | 38 | 3.0 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 7 | PF00344.22 | 0.76 | 29 | 701 | same-strand | SecY |
| 8 | PF00406.24 | 0.68 | 26 | 2145.0 | same-strand | Adenylate kinase |
| 9 | PF13207.8 | 0.68 | 26 | 2145.0 | same-strand | AAA domain |
| 10 | PF13238.8 | 0.68 | 26 | 2145.0 | same-strand | AAA domain |
| 11 | PF13671.8 | 0.66 | 25 | 2151 | same-strand | AAA domain |
++ More..