Result : EXP02244
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02244 |
| NCBI Accession ID | CP001363.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 2083025 |
| Right | 2083243 |
| Strand | - |
| Nucleotide Sequence | GTGAAAGCGTTTCATCTGATACAGGAGGCAGGTATGGTCTTTTCTGTCAGTGAGGAAGTTACCGTGAAAGAGGGTGGGCCCCGGATGATCGTCACCGGTTATTCCAGCGGAATGGTAGAGTGTCGCTGGTATGATGGTTTTGGCGTAAAGCGGGAGGCATTCCATGAGAATGAGCTCGTGCCAGGCAAGGAAAGGCGCGTGCGGGACGAAGCCCGATGA |
| Sequence | VKAFHLIQEAGMVFSVSEEVTVKEGGPRMIVTGYSSGMVECRWYDGFGVKREAFHENELVPGKERRVRDEAR |
| Source of smORF | Protein-level |
| Function | The protein encoded by this ORF is under the control of the RNA Polymerase sigma factor RpoS which plays a role in general stress response. It is abundantly expressed in the stationary phase. Pubmed:28522802 The ORF matches to the profile of cl02293. Profile Description: Uncharacterized small protein (DUF2158). Members of this family of prokaryotic proteins have no known function. |
| Pubmed ID | 28522802 |
| Domain | CDD:413264 |
| Functional Category | Manually curated function from literature |
| Uniprot ID | P64518 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 55
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2071617 | 2071835 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 80820 | 81038 | - | NZ_CP053416.1 | Salmonella bongori |
| 3 | 2139690 | 2139908 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 4 | 982487 | 982702 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 5 | 4359183 | 4359368 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 6 | 740834 | 741019 | - | NZ_CP033744.1 | Citrobacter freundii |
| 7 | 979056 | 979268 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 1526800 | 1527012 | - | NZ_CP038469.1 | Citrobacter tructae |
| 9 | 733691 | 733873 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 10 | 1837987 | 1838169 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 11 | 1957190 | 1957372 | - | NZ_AP014857.1 | Escherichia albertii |
| 12 | 2926701 | 2926883 | - | NC_015968.1 | Enterobacter soli |
| 13 | 552978 | 553193 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 14 | 2591723 | 2591905 | - | NZ_LR134340.1 | Escherichia marmotae |
| 15 | 2080370 | 2080552 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 16 | 3124286 | 3124468 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 17 | 5078142 | 5078324 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 18 | 2170236 | 2170418 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 19 | 3222710 | 3222892 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 20 | 3024760 | 3024942 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 21 | 2616432 | 2616614 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 22 | 2028188 | 2028370 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 23 | 2652871 | 2653053 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 24 | 2923021 | 2923203 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 25 | 75068 | 75250 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 26 | 2993868 | 2994050 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 27 | 2028054 | 2028236 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 28 | 2648730 | 2648906 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 29 | 4335710 | 4335892 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 30 | 4195440 | 4195652 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 31 | 2925343 | 2925525 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 32 | 2909421 | 2909603 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 33 | 4285035 | 4285217 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 34 | 1753126 | 1753308 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 35 | 2798034 | 2798216 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 36 | 2443297 | 2443479 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 37 | 1615508 | 1615687 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 38 | 1704284 | 1704466 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 39 | 1164125 | 1164307 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 40 | 1735748 | 1735927 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 41 | 138873 | 139055 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 42 | 1459270 | 1459452 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 43 | 743156 | 743338 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 44 | 2675713 | 2675895 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 45 | 2702967 | 2703149 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 46 | 1735866 | 1736048 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 47 | 1257337 | 1257519 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 48 | 1674017 | 1674196 | + | NZ_LR134201.1 | Cedecea lapagei |
| 49 | 1753463 | 1753642 | + | NZ_CP023525.1 | Cedecea neteri |
| 50 | 2157292 | 2157471 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 51 | 2252505 | 2252684 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 52 | 5303653 | 5303832 | - | NZ_CP026047.1 | Raoultella planticola |
| 53 | 1963104 | 1963283 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 54 | 1924662 | 1924841 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 55 | 1900517 | 1900696 | + | NZ_CP041247.1 | Raoultella electrica |
| 56 | 1894257 | 1894439 | + | NC_017554.1 | Pantoea ananatis PA13 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00196.21 | 0.89 | 49 | 3511.5 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 2 | PF10781.11 | 0.96 | 53 | 3226.0 | same-strand | Dextransucrase DSRB |
| 3 | PF10733.11 | 0.98 | 54 | 2865 | opposite-strand | Protein of unknown function (DUF2525) |
| 4 | PF08282.14 | 0.62 | 34 | 1773 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 5 | PF17151.6 | 0.89 | 49 | 113.5 | same-strand | Periplasmic sensor domain |
| 6 | PF00990.23 | 0.91 | 50 | 119 | same-strand | Diguanylate cyclase, GGDEF domain |
| 7 | PF05661.14 | 1.0 | 55 | 79.0 | same-strand | Protein of unknown function (DUF808) |
| 8 | PF00892.22 | 0.96 | 53 | 1169.0 | opposite-strand | EamA-like transporter family |
| 9 | PF03852.17 | 1.0 | 55 | 2057.0 | same-strand | DNA mismatch endonuclease Vsr |
| 10 | PF00145.19 | 0.82 | 45 | 2528.0 | same-strand | C-5 cytosine-specific DNA methylase |
| 11 | PF18284.3 | 0.82 | 45 | 2528.0 | same-strand | DNA methylase N-terminal domain |
| 12 | PF01966.24 | 0.91 | 50 | 4005 | same-strand | HD domain |
++ More..