Result : EXP02240
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02240 |
| NCBI Accession ID | CP001363.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 2079817 |
| Right | 2080044 |
| Strand | + |
| Nucleotide Sequence | ATGAAAACGGCAAAAGAGTACAGTGATACGGCCAAGCGCGAAGTGAGCGTCGATGTAGATGCGCTACTGGCGGCCATCAATGAAATCAGCGAAAGCGAGGTTCACCGTAGCCAGGAAGATCCTGAGCGGGTGAGCGTAGACGGACGGGAATATCATACATGGCATGAATTAGCTGAAGCATTCGAGCTGGATATTCATGATTTTAGTGTAACAGAAGTAAACCGTTAA |
| Sequence | MKTAKEYSDTAKREVSVDVDALLAAINEISESEVHRSQEDPERVSVDGREYHTWHELAEAFELDIHDFSVTEVNR |
| Source of smORF | Protein-level |
| Function | The protein encoded by this ORF is under the control of the RNA Polymerase sigma factor RpoS which plays a role in general stress response. It is abundantly expressed in the stationary phase. Pubmed:28522802 The ORF matches to the profile of pfam10733. Profile Description: Protein of unknown function (DUF2525). This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. The family has a highly conserved sequence. |
| Pubmed ID | 28522802 |
| Domain | CDD:402389 |
| Functional Category | Manually curated function from literature |
| Uniprot ID | P64520 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 56
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2068409 | 2068636 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 2136550 | 2136777 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 3 | 4281892 | 4282119 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 4 | 2651834 | 2652061 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 5 | 77606 | 77833 | + | NZ_CP053416.1 | Salmonella bongori |
| 6 | 984687 | 984914 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 7 | 4359575 | 4359802 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 8 | 740400 | 740627 | + | NZ_CP033744.1 | Citrobacter freundii |
| 9 | 975909 | 976136 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 10 | 1526366 | 1526593 | + | NZ_CP038469.1 | Citrobacter tructae |
| 11 | 2613230 | 2613457 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 12 | 2024986 | 2025213 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 13 | 2649669 | 2649896 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 14 | 2588500 | 2588727 | + | NZ_LR134340.1 | Escherichia marmotae |
| 15 | 2024852 | 2025079 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 16 | 1618456 | 1618683 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 17 | 1701137 | 1701364 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 18 | 1738936 | 1739163 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 19 | 1167215 | 1167445 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 20 | 3121240 | 3121470 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 21 | 2083376 | 2083606 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 22 | 2790801 | 2791028 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 23 | 5081316 | 5081546 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 24 | 78058 | 78288 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 25 | 2990830 | 2991060 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 26 | 2446376 | 2446606 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 27 | 556058 | 556285 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 28 | 2167147 | 2167374 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 29 | 1840968 | 1841198 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 30 | 2922255 | 2922482 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 31 | 2919940 | 2920167 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 32 | 1965354 | 1965581 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 33 | 5301355 | 5301582 | + | NZ_CP026047.1 | Raoultella planticola |
| 34 | 3021673 | 3021900 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 35 | 1953986 | 1954192 | + | NZ_AP014857.1 | Escherichia albertii |
| 36 | 4338753 | 4338980 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 37 | 3219623 | 3219850 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 38 | 730593 | 730820 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 39 | 2906334 | 2906561 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 40 | 1902772 | 1902999 | - | NZ_CP041247.1 | Raoultella electrica |
| 41 | 2159576 | 2159791 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 42 | 2254789 | 2255004 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 43 | 1926934 | 1927161 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 44 | 2017174 | 2017398 | - | NZ_CP050508.1 | Raoultella terrigena |
| 45 | 1738952 | 1739167 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 46 | 2923575 | 2923787 | + | NC_015968.1 | Enterobacter soli |
| 47 | 135458 | 135685 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 48 | 1861248 | 1861457 | - | NZ_CP054254.1 | Klebsiella variicola |
| 49 | 1755503 | 1755709 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 50 | 1793207 | 1793416 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 51 | 3417438 | 3417659 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 52 | 1676515 | 1676748 | - | NZ_LR134201.1 | Cedecea lapagei |
| 53 | 4487700 | 4487912 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 54 | 1755927 | 1756160 | - | NZ_CP023525.1 | Cedecea neteri |
| 55 | 3002752 | 3002985 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 56 | 1883079 | 1883312 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 57 | 1607309 | 1607524 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00813.22 | 0.7 | 39 | 2378.0 | same-strand | FliP family |
| 2 | PF01313.21 | 0.73 | 41 | 2101.0 | same-strand | Bacterial export proteins, family 3 |
| 3 | PF01311.22 | 0.75 | 42 | 1308 | same-strand | Bacterial export proteins, family 1 |
| 4 | PF00196.21 | 0.95 | 53 | 395.0 | same-strand | Bacterial regulatory proteins, luxR family |
| 5 | PF10781.11 | 1.0 | 56 | 132 | opposite-strand | Dextransucrase DSRB |
| 6 | PF17151.6 | 0.88 | 49 | 1086.0 | opposite-strand | Periplasmic sensor domain |
| 7 | PF00990.23 | 0.91 | 51 | 1086.0 | opposite-strand | Diguanylate cyclase, GGDEF domain |
| 8 | PF09926.11 | 0.89 | 50 | 2860 | opposite-strand | Uncharacterized small protein (DUF2158) |
| 9 | PF05661.14 | 0.96 | 54 | 3115 | opposite-strand | Protein of unknown function (DUF808) |
| 10 | PF00892.22 | 0.91 | 51 | 4208.0 | same-strand | EamA-like transporter family |
++ More..