Result : EXP02238
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02238 |
| NCBI Accession ID | CP001363.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 442110 |
| Right | 442301 |
| Strand | + |
| Nucleotide Sequence | ATGCCAACCAGACCACCTTATCCGCGGGAAGCTTATATCGTCACCATTGAAAAAGGCACGCCGGGCCAGACGGTGACGTGGTATCAGCTACGGGCTGACCATCCGAAACCTGATTCGCTCACCAGCGAGCATCCGACCGCAGAAGAAGCGATGGATGCGAAAAATCGTTACGAAGATCCGGATAAATCATAG |
| Sequence | MPTRPPYPREAYIVTIEKGTPGQTVTWYQLRADHPKPDSLTSEHPTAEEAMDAKNRYEDPDKS |
| Source of smORF | Protein-level |
| Function | The protein encoded by this ORF is under the control of the RNA Polymerase sigma factor RpoS which plays a role in general stress response. It is abundantly expressed in the stationary phase. Pubmed:28522802 The ORF matches to the profile of cl25664. Profile Description: YaiA protein. hypothetical protein; Provisional |
| Pubmed ID | 28522802 |
| Domain | CDD:421105 |
| Functional Category | Manually curated function from literature |
| Uniprot ID | P0AAN8 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 73
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 441418 | 441609 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 2982589 | 2982780 | + | NZ_CP053416.1 | Salmonella bongori |
| 3 | 483803 | 483994 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 4 | 2597738 | 2597929 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 5 | 4516015 | 4516206 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 6 | 336222 | 336413 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 406979 | 407170 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 8 | 466759 | 466950 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 9 | 1048799 | 1048990 | + | NZ_LR134340.1 | Escherichia marmotae |
| 10 | 3270595 | 3270786 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 11 | 2579787 | 2579978 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 12 | 1687900 | 1688091 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 13 | 1219804 | 1219995 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 14 | 3898949 | 3899140 | + | NZ_CP033744.1 | Citrobacter freundii |
| 15 | 2254714 | 2254905 | - | NZ_CP038469.1 | Citrobacter tructae |
| 16 | 4179397 | 4179588 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 17 | 921370 | 921561 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 18 | 2725654 | 2725845 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 19 | 3521897 | 3522088 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 20 | 1046460 | 1046651 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 21 | 126892 | 127083 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 22 | 1951710 | 1951901 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 23 | 1208683 | 1208874 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 24 | 4714525 | 4714716 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 25 | 3474486 | 3474677 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 26 | 3598549 | 3598740 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 27 | 3771836 | 3772027 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 28 | 1017796 | 1017987 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 29 | 2382589 | 2382780 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 30 | 1054542 | 1054733 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 31 | 3089829 | 3090020 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 32 | 1053420 | 1053611 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 33 | 1009218 | 1009409 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 34 | 967803 | 967994 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 35 | 4772713 | 4772904 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 36 | 1541415 | 1541606 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 37 | 4082545 | 4082736 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 38 | 1128401 | 1128592 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 39 | 1063008 | 1063199 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 40 | 2009102 | 2009293 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 41 | 1053160 | 1053351 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 42 | 2571451 | 2571642 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 43 | 2981370 | 2981561 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 44 | 4384127 | 4384318 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 45 | 4350373 | 4350564 | - | NZ_CP054254.1 | Klebsiella variicola |
| 46 | 4067732 | 4067923 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 47 | 3595884 | 3596075 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 48 | 4692722 | 4692913 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 49 | 2149416 | 2149607 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 50 | 2875632 | 2875823 | + | NZ_CP026047.1 | Raoultella planticola |
| 51 | 4369264 | 4369455 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 52 | 964044 | 964235 | + | NC_015968.1 | Enterobacter soli |
| 53 | 1025785 | 1025976 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 54 | 4474128 | 4474319 | - | NZ_CP050508.1 | Raoultella terrigena |
| 55 | 3550359 | 3550550 | - | NZ_LR134201.1 | Cedecea lapagei |
| 56 | 1001146 | 1001337 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 57 | 2868945 | 2869136 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 58 | 3860731 | 3860922 | - | NZ_CP023525.1 | Cedecea neteri |
| 59 | 3193497 | 3193688 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 60 | 4138872 | 4139063 | - | NZ_CP041247.1 | Raoultella electrica |
| 61 | 400775 | 400966 | + | NZ_CP028271.1 | Mixta intestinalis |
| 62 | 3533992 | 3534183 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 63 | 436125 | 436316 | - | NZ_CP019706.1 | Pantoea alhagi |
| 64 | 913295 | 913486 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 65 | 3517397 | 3517588 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 66 | 1157608 | 1157799 | + | NZ_CP061511.1 | Mixta calida |
| 67 | 3866394 | 3866585 | + | NZ_CP049115.1 | Pantoea stewartii |
| 68 | 1234609 | 1234800 | + | NZ_CP026377.1 | Mixta gaviniae |
| 69 | 3131752 | 3131943 | - | NZ_CP038853.1 | Pantoea vagans |
| 70 | 1122430 | 1122621 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 71 | 3161318 | 3161512 | + | NZ_CP011254.1 | Serratia fonticola |
| 72 | 3487993 | 3488184 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 73 | 776145 | 776336 | - | NZ_CP050150.1 | Hafnia alvei |
| 74 | 1022659 | 1022838 | + | NZ_LN907827.1 | Erwinia gerundensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07769.16 | 0.63 | 46 | 3308 | same-strand | psiF repeat |
| 2 | PF14748.8 | 0.81 | 59 | 1445.0 | opposite-strand | Pyrroline-5-carboxylate reductase dimerisation |
| 3 | PF03807.19 | 0.81 | 59 | 1445.0 | opposite-strand | NADP oxidoreductase coenzyme F420-dependent |
| 4 | PF02639.16 | 0.96 | 70 | 850 | same-strand | Uncharacterized BCR, YaiI/YqxD family COG1671 |
| 5 | PF01202.24 | 0.99 | 72 | 51 | same-strand | Shikimate kinase |
| 6 | PF13238.8 | 0.99 | 72 | 51 | same-strand | AAA domain |
| 7 | PF07302.13 | 0.9 | 66 | 254 | same-strand | AroM protein |
| 8 | PF06865.13 | 0.99 | 72 | 1007 | same-strand | Pyrimidine/purine nucleoside phosphorylase |
| 9 | PF04381.14 | 0.92 | 67 | 1342.0 | opposite-strand | Putative exonuclease, RdgC |
| 10 | PF00480.22 | 0.89 | 65 | 2361 | same-strand | ROK family |
++ More..