Result : EXP02237
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02237 |
| NCBI Accession ID | CP001363.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 409241 |
| Right | 409342 |
| Strand | + |
| Nucleotide Sequence | ATGCTAAATAGATACTACCGTTTCGCTGTCGAAAAAGACGACCCCTCCGAAGCGCCAGAGTCGGGCGATAAGCCTGACAGCCAGCCGCAAAAAAAATCGTAA |
| Sequence | MLNRYYRFAVEKDDPSEAPESGDKPDSQPQKKS |
| Source of smORF | Protein-level |
| Function | The protein encoded by this ORF is under the control of the RNA Polymerase sigma factor RpoS which plays a role in general stress response. It is abundantly expressed in the stationary phase. Pubmed:28522802 |
| Pubmed ID | 28522802 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 408549 | 408650 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 2945940 | 2946041 | + | NZ_CP053416.1 | Salmonella bongori |
| 3 | 431121 | 431222 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 4 | 1497325 | 1497414 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 5 | 1371567 | 1371671 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 6 | 2562575 | 2562664 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 7 | 942314 | 942403 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 8 | 2522447 | 2522539 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
++ More..