ProsmORF-pred
Result : EXP02235
Protein Information
Information Type Description
Protein name EXP02235
NCBI Accession ID CP040530.1
Organism Bacteroides thetaiotaomicron strain DSM 2079
Left 5522996
Right 5523181
Strand -
Nucleotide Sequence ATGAGTATAGAAGATGCAATCATGGGTGGAATCGTCTTTAAAGGTAAGAAAGATAAGCCCCAGGAGGAGGAGAAAGTGAAGACGAAAGCGAAGAAAGCGACTTATATTCGTGGACAACATGGTTCCGGAGCCGCGAAGATGAAAGCGGATATTCGGAAAAAGAGAGCTAACCGACATAAAAAATAA
Sequence MSIEDAIMGGIVFKGKKDKPQEEEKVKTKAKKATYIRGQHGSGAAKMKADIRKKRANRHKK
Source of smORF Protein-level
Function
Pubmed ID 33622394
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 61
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 18
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 5522996 5523181 - NZ_CP040530.1 Bacteroides thetaiotaomicron
2 2270625 2270810 - NC_014933.1 Bacteroides helcogenes P 36-108
3 2002102 2002287 - NZ_CP012938.1 Bacteroides ovatus
4 2782568 2782753 - NZ_CP015401.2 Bacteroides caecimuris
5 1698004 1698192 + NZ_LN877293.1 Bacteroides fragilis
6 3208400 3208585 + NZ_CP027231.1 Bacteroides zoogleoformans
7 328563 328748 - NZ_CP027234.1 Bacteroides heparinolyticus
8 2177174 2177365 + NC_009614.1 Phocaeicola vulgatus ATCC 8482
9 2291910 2292101 + NZ_LR699004.1 Phocaeicola dorei
10 1654368 1654526 + NZ_LR215980.1 Paraprevotella xylaniphila YIT 11841
11 119196 119387 + NZ_CP069440.1 Phocaeicola coprophilus
12 2149046 2149234 - NC_015164.1 Phocaeicola salanitronis DSM 18170
13 1085718 1085870 + NZ_CP012074.1 Prevotella fusca JCM 17724
14 526428 526580 - NZ_CP023863.1 Prevotella jejuni
15 2317243 2317431 + NC_014033.1 Prevotella ruminicola 23
16 517231 517383 - NC_014370.1 Prevotella melaninogenica ATCC 25845
17 1985310 1985462 - NZ_CP024727.1 Prevotella intermedia
18 2031653 2031850 - NZ_CP013195.1 Prevotella enoeca
++ More..