Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02233 |
NCBI Accession ID | CP040530.1 |
Organism | Bacteroides thetaiotaomicron strain DSM 2079 |
Left | 3582899 |
Right | 3583072 |
Strand | + |
Nucleotide Sequence | ATGGCAAGACCGATAAAAGAAACTCCGATACTCTTCGGGGAGGATGCACGGAGATTTGAAGCGCGGATGAAAAATCCACCGAAAGAGACTCCGGAAAAGCTGGAAGAGATAAAACGGGATTATAAGTACATCATGAGCATTTTTAAAGAAGAAACTGATGGCAGAAATAAATAA |
Sequence | MARPIKETPILFGEDARRFEARMKNPPKETPEKLEEIKRDYKYIMSIFKEETDGRNK |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 33622394 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 57 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3582899 | 3583072 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
2 | 6236439 | 6236591 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
3 | 566155 | 566307 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
4 | 573484 | 573648 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
5 | 4253329 | 4253493 | - | NZ_LN877293.1 | Bacteroides fragilis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13149.8 | 0.67 | 2 | 655 | same-strand | Fimbrillin-like |