Result : EXP02233
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02233 |
| NCBI Accession ID | CP040530.1 |
| Organism | Bacteroides thetaiotaomicron strain DSM 2079 |
| Left | 3582899 |
| Right | 3583072 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAGACCGATAAAAGAAACTCCGATACTCTTCGGGGAGGATGCACGGAGATTTGAAGCGCGGATGAAAAATCCACCGAAAGAGACTCCGGAAAAGCTGGAAGAGATAAAACGGGATTATAAGTACATCATGAGCATTTTTAAAGAAGAAACTGATGGCAGAAATAAATAA |
| Sequence | MARPIKETPILFGEDARRFEARMKNPPKETPEKLEEIKRDYKYIMSIFKEETDGRNK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 33622394 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3582899 | 3583072 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 6236439 | 6236591 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 3 | 566155 | 566307 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 4 | 573484 | 573648 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 5 | 4253329 | 4253493 | - | NZ_LN877293.1 | Bacteroides fragilis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014933.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13149.8 | 0.67 | 2 | 655 | same-strand | Fimbrillin-like |
++ More..