Result : EXP02232
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02232 |
| NCBI Accession ID | CP040530.1 |
| Organism | Bacteroides thetaiotaomicron strain DSM 2079 |
| Left | 4999582 |
| Right | 4999749 |
| Strand | - |
| Nucleotide Sequence | ATGGCTATAACTATCAAGAACATTCCGGTTTTGGAGGGCGTTACGGCGGAAGATTTCGTACGCAGTGCAGACAAGAACGCCGCAAAGGTAACACCCCGGTTATCAGTGGAGGCAAAGAAACGGTTGCGAAAAGTATTGGAGAAATCCCGTTCATTCCGGTTCAATTAA |
| Sequence | MAITIKNIPVLEGVTAEDFVRSADKNAAKVTPRLSVEAKKRLRKVLEKSRSFRFN |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 33622394 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2407605 | 2407772 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 2 | 4999582 | 4999749 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 3 | 853094 | 853261 | + | NZ_LR699004.1 | Phocaeicola dorei |
| 4 | 3403801 | 3403968 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 5 | 516916 | 517083 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 6 | 3524283 | 3524447 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP054012.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00589.24 | 0.6 | 3 | 508 | same-strand | Phage integrase family |
| 2 | PF12728.9 | 0.6 | 3 | 3071 | opposite-strand | Helix-turn-helix domain |
++ More..