Result : EXP02231

Protein Information

• Protein name: EXP02231
• NCBI Accession ID: CP040530.1
• Organism: Bacteroides thetaiotaomicron strain DSM 2079
• Left: 5878829
• Right: 5878990
• Strand: -
• Nucleotide Sequence: ATGAGTAGCAGTATGTTGGAACAAAGAAGTCGTTTTGCGATGATCGGTGCATTAATGATCATCATCAGCCTGATGTTTTGGTATTATATGGGGAGTTCGCTGGTTAGTGCTACAAAGAAGTACCTCGAACAGGTACAGACAATAGAGATCACTTGCGAGTAA
• Sequence: MSSSMLEQRSRFAMIGALMIIISLMFWYYMGSSLVSATKKYLEQVQTIEITCE
• Source of smORF: Protein-level
• Pubmed ID: 33622394
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 53

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	5878829	5878990	-	NZ_CP040530.1	Bacteroides thetaiotaomicron
2	2317448	2317621	-	NZ_CP012938.1	Bacteroides ovatus
3	3728121	3728282	-	NZ_LN877293.1	Bacteroides fragilis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP040530.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00118.26	0.67	2	4275.5	same-strand	TCP-1/cpn60 chaperonin family
2	PF00166.23	0.67	2	3959.0	same-strand	Chaperonin 10 Kd subunit
3	PF03734.16	0.67	2	2668.0	opposite-strand	L,D-transpeptidase catalytic domain
4	PF00293.30	0.67	2	42.5	same-strand	NUDIX domain
5	PF02906.16	0.67	2	201.5	opposite-strand	Iron only hydrogenase large subunit, C-terminal domain
6	PF00037.29	0.67	2	201.5	opposite-strand	4Fe-4S binding domain
7	PF12838.9	0.67	2	201.5	opposite-strand	4Fe-4S dicluster domain
8	PF13187.8	0.67	2	201.5	opposite-strand	4Fe-4S dicluster domain
9	PF12837.9	0.67	2	201.5	opposite-strand	4Fe-4S binding domain
10	PF13237.8	0.67	2	201.5	opposite-strand	4Fe-4S dicluster domain
11	PF14697.8	0.67	2	201.5	opposite-strand	4Fe-4S dicluster domain
12	PF12797.9	0.67	2	201.5	opposite-strand	4Fe-4S binding domain
13	PF04055.23	0.67	2	2176.0	opposite-strand	Radical SAM superfamily
14	PF06968.15	0.67	2	2697.0	opposite-strand	Biotin and Thiamin Synthesis associated domain
15	PF18133.3	0.67	2	4187.0	opposite-strand	Hydrogen maturase F tetramerization domain
16	PF18128.3	0.67	2	4187.0	opposite-strand	Hydrogen maturase F dimerization domain
17	PF01926.25	0.67	2	4187.0	opposite-strand	50S ribosome-binding GTPase
18	PF00326.23	0.67	2	5172.5	opposite-strand	Prolyl oligopeptidase family