Result : EXP02230
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02230 |
| NCBI Accession ID | CP040530.1 |
| Organism | Bacteroides thetaiotaomicron strain DSM 2079 |
| Left | 2564365 |
| Right | 2564463 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAGTTAGAAAGATTGTTTAGAAAGATCGGCAATGCCGATGTACATGTTTGGGGATACTCAACACTTGGCATACTCCCCAAAGAGAAGATTTAA |
| Sequence | MKKLERLFRKIGNADVHVWGYSTLGILPKEKI |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 33622394 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2564365 | 2564463 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 5529186 | 5529278 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 520049 | 520141 | + | NZ_CP015401.2 | Bacteroides caecimuris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03993.14 | 1.0 | 3 | 5229 | opposite-strand | Domain of Unknown Function (DUF349) |
| 2 | PF01769.18 | 1.0 | 3 | 3803 | opposite-strand | Divalent cation transporter |
| 3 | PF03448.19 | 1.0 | 3 | 3803 | opposite-strand | MgtE intracellular N domain |
| 4 | PF00571.30 | 1.0 | 3 | 3803 | opposite-strand | CBS domain |
| 5 | PF00398.22 | 1.0 | 3 | 2937 | opposite-strand | Ribosomal RNA adenine dimethylase |
| 6 | PF03706.15 | 1.0 | 3 | 1834 | same-strand | Lysylphosphatidylglycerol synthase TM region |
| 7 | PF01546.30 | 1.0 | 3 | 255 | same-strand | Peptidase family M20/M25/M40 |
| 8 | PF07687.16 | 1.0 | 3 | 255 | same-strand | Peptidase dimerisation domain |
| 9 | PF17973.3 | 1.0 | 3 | 1325 | same-strand | Bacterial Alpha-2-macroglobulin MG10 domain |
| 10 | PF00207.24 | 1.0 | 3 | 1325 | same-strand | Alpha-2-macroglobulin family |
| 11 | PF01835.21 | 1.0 | 3 | 1325 | same-strand | MG2 domain |
| 12 | PF07610.13 | 1.0 | 3 | 7283 | same-strand | Protein of unknown function (DUF1573) |
| 13 | PF03308.18 | 1.0 | 3 | 8364 | same-strand | Methylmalonyl Co-A mutase-associated GTPase MeaB |
++ More..