Protein name |
EXP02224 |
NCBI Accession ID |
CP039126.1 |
Organism |
Blautia producta strain DSM 2950 |
Left |
2548143 |
Right |
2548316 |
Strand |
+ |
Nucleotide Sequence |
ATGAACTATGCTTGTGTTTCAAAACAGCCTTTTATTACAAAAAAAGATTTATCTGTGAAAAAGCCTTTGCTGGCTGAAGCAAAGTCACGGAGAGAGTTTATTCGTTCTCATGATTTTACAGTCAATGTTGATCCTTCTACAAAAATAGCGGAGATAAAAGTTACGAAGAGGTAA |
Sequence |
MNYACVSKQPFITKKDLSVKKPLLAEAKSRREFIRSHDFTVNVDPSTKIAEIKVTKR |
Source of smORF |
Protein-level |
Function |
Expressed by the bacterium uniquely when cultured in the SIHUMIx community(simplified human intestinal microbiota) as compared to when it is cultivated as a single strain. This suggests a plausible role in the community organisation. Pubmed:33622394 |
Pubmed ID |
33622394
|
Domain |
|
Functional Category |
Manually curated function from literature |
Uniprot ID |
|
ORF Length (Amino Acid) |
57 |