Result : EXP02222
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02222 |
| NCBI Accession ID | CP039126.1 |
| Organism | Blautia producta strain DSM 2950 |
| Left | 5172129 |
| Right | 5172278 |
| Strand | - |
| Nucleotide Sequence | ATGATTAATTACGAGGAAGAACTGAAGAAATTCCAGCCGTGCCTGGACGTGGATGATGCGGAAGGCAACATTTACAAGCAGGATTTAACGGATGTGATCGATATTTTGAAGGAAATGCTGAAAGAAACCAATGGAACGGCTAAGAATTAG |
| Sequence | MINYEEELKKFQPCLDVDDAEGNIYKQDLTDVIDILKEMLKETNGTAKN |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 33622394 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5172129 | 5172278 | - | NZ_CP039126.1 | Blautia producta |
| 2 | 466016 | 466165 | + | NZ_CP030280.1 | Blautia argi |
| 3 | 2533815 | 2533964 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 4 | 94991 | 95134 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 5 | 545216 | 545350 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 6 | 1861650 | 1861784 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 7 | 2639199 | 2639363 | - | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 8 | 909172 | 909315 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 9 | 2763938 | 2764072 | + | NZ_CP070062.1 | Coprococcus comes |
| 10 | 877116 | 877259 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 11 | 604694 | 604831 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 12 | 2158596 | 2158730 | - | NZ_LN879430.1 | Herbinix luporum |
| 13 | 234937 | 235077 | - | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 14 | 737649 | 737792 | + | NZ_LR699011.1 | Roseburia hominis |
| 15 | 1702896 | 1703036 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 16 | 2847866 | 2848012 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 17 | 4469316 | 4469456 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP022413.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04542.16 | 0.82 | 14 | 2430.5 | same-strand | Sigma-70 region 2 |
| 2 | PF04545.18 | 0.82 | 14 | 2430.5 | same-strand | Sigma-70, region 4 |
| 3 | PF13581.8 | 0.88 | 15 | 2015 | same-strand | Histidine kinase-like ATPase domain |
| 4 | PF02518.28 | 0.88 | 15 | 2015 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 5 | PF13466.8 | 0.82 | 14 | 1587.0 | same-strand | STAS domain |
| 6 | PF01740.23 | 0.88 | 15 | 1581 | same-strand | STAS domain |
| 7 | PF00133.24 | 0.94 | 16 | 2801.5 | same-strand | tRNA synthetases class I (I, L, M and V) |
| 8 | PF08264.15 | 0.94 | 16 | 2801.5 | same-strand | Anticodon-binding domain of tRNA ligase |
| 9 | PF10458.11 | 0.94 | 16 | 2801.5 | same-strand | Valyl tRNA synthetase tRNA binding arm |
| 10 | PF07719.19 | 0.65 | 11 | 37 | same-strand | Tetratricopeptide repeat |
++ More..