Result : EXP02221
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02221 |
| NCBI Accession ID | CP039126.1 |
| Organism | Blautia producta strain DSM 2950 |
| Left | 2161687 |
| Right | 2161833 |
| Strand | + |
| Nucleotide Sequence | ATGGATAAAAAACAGCAGGAAGCTTTAAACAGAAAGAAGTCAAATGAAACCTTCAACAGCATTACCCAGAAGGTAAAGCCGGAAAATCAGAATCAGCAGCACAATGCCAGGTCTGAGGCTGTGGAACCGAAAATCAGGCAGGTATAG |
| Sequence | MDKKQQEALNRKKSNETFNSITQKVKPENQNQQHNARSEAVEPKIRQV |
| Source of smORF | Protein-level |
| Function | Expressed by the bacterium uniquely when cultured in the SIHUMIx community(simplified human intestinal microbiota) as compared to when it is cultivated as a single strain. This suggests a plausible role in the community organisation. Pubmed:33622394 |
| Pubmed ID | 33622394 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2161687 | 2161833 | + | NZ_CP039126.1 | Blautia producta |
| 2 | 1574602 | 1574748 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 3 | 4559934 | 4560086 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 4 | 2566876 | 2567022 | - | NZ_LN879430.1 | Herbinix luporum |
| 5 | 2606841 | 2606987 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 6 | 1464141 | 1464287 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
++ More..