Result : EXP02211
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02211 |
| NCBI Accession ID | NC_002947.3 |
| Organism | Pseudomonas putida KT2440 |
| Left | 3890742 |
| Right | 3890849 |
| Strand | - |
| Nucleotide Sequence | ATGACATACCATGGGTTCAAGCTGATCATAGGTGACTACCTCGCCCGTAGCGTGCGGGGCATTCCGTGCTCACCGCCGTTCCTGTTCCACATCCCACGCAATCAATAA |
| Sequence | MTYHGFKLIIGDYLARSVRGIPCSPPFLFHIPRNQ |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 27717237 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3163408 | 3163515 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 2 | 3241628 | 3241735 | - | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 3 | 3088726 | 3088830 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 4 | 3269608 | 3269712 | - | NC_008027.1 | Pseudomonas entomophila L48 |
| 5 | 1812578 | 1812682 | + | NZ_CP009365.1 | Pseudomonas soli |
| 6 | 403800 | 403907 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 7 | 3338121 | 3338225 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 8 | 2472462 | 2472566 | + | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 9 | 3831178 | 3831282 | - | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 10 | 3597794 | 3597886 | - | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 11 | 233835 | 233939 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 12 | 3689081 | 3689185 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
| 13 | 4058568 | 4058672 | - | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 14 | 3599689 | 3599793 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 15 | 1243007 | 1243111 | - | NZ_CP014262.1 | Pseudomonas corrugata |
| 16 | 2566720 | 2566824 | + | NZ_CP035088.1 | Pseudomonas viciae |
| 17 | 1469279 | 1469383 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 18 | 1935387 | 1935491 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 19 | 3769592 | 3769696 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 20 | 3125924 | 3126028 | - | NZ_CP023272.1 | Pseudomonas lurida |
| 21 | 3609032 | 3609136 | - | NZ_CP018420.1 | Pseudomonas veronii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP022562.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12792.9 | 0.95 | 20 | 1121 | opposite-strand | CSS motif domain associated with EAL |
| 2 | PF14696.8 | 1.0 | 21 | 37 | same-strand | Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal |
| 3 | PF00903.27 | 1.0 | 21 | 38.0 | same-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 4 | PF00563.22 | 0.9 | 19 | 289 | opposite-strand | EAL domain |
| 5 | PF00892.22 | 0.76 | 16 | 1241 | opposite-strand | EamA-like transporter family |
++ More..