Result : EXP02207
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02207 |
| NCBI Accession ID | NC_002947.3 |
| Organism | Pseudomonas putida KT2440 |
| Left | 3466126 |
| Right | 3466245 |
| Strand | - |
| Nucleotide Sequence | ATGCCGAAACACACCCGCAACCACGCCAACCACACCGGTCGCAGCCTGCGCCCTGTGCTGGCCGTTGCCGGCTGCGTGGCACCTGCCAGCTATTACTTTGGGTATTGGTTTAGCCACTAG |
| Sequence | MPKHTRNHANHTGRSLRPVLAVAGCVAPASYYFGYWFSH |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 27717237 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2871926 | 2872045 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 2 | 2765658 | 2765777 | - | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 3 | 549391 | 549510 | - | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 4 | 3362461 | 3362580 | + | NC_008027.1 | Pseudomonas entomophila L48 |
| 5 | 2176117 | 2176236 | + | NZ_CP009365.1 | Pseudomonas soli |
| 6 | 2965116 | 2965235 | + | NZ_CP024159.1 | Pseudomonas mosselii |
| 7 | 3136105 | 3136239 | + | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 8 | 2925953 | 2926084 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 9 | 3398617 | 3398745 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_021505.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00528.24 | 0.78 | 7 | 3760 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 2 | PF00496.24 | 0.89 | 8 | 1809.0 | same-strand | Bacterial extracellular solute-binding proteins, family 5 Middle |
| 3 | PF00639.23 | 1.0 | 9 | 1476 | same-strand | PPIC-type PPIASE domain |
| 4 | PF00793.22 | 1.0 | 9 | 333 | same-strand | DAHP synthetase I family |
| 5 | PF13616.8 | 0.67 | 6 | 1490.0 | same-strand | PPIC-type PPIASE domain |
++ More..