Result : B3QZS8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CU469464.1 |
| Organism | Phytoplasma mali (strain AT) |
| Left | 358108 |
| Right | 358296 |
| Strand | + |
| Nucleotide Sequence | ATGGGAAGATGTTATATTTCACAAAAATCAACTTTATTTGGTAATAAACGTAGTCATTCTATGAATGCAATCAAAAGAATTTGGAAAACAAATTTACAAAGTATTAGAATTGAAGATGAAAATGGTAAAATTAAAAAAATTAAAATATCTGCCCGTTCTTTAAAAAAATTAAATTTTAAAAGAGTTTGA |
| Sequence | MGRCYISQKSTLFGNKRSHSMNAIKRIWKTNLQSIRIEDENGKIKKIKISARSLKKLNFKRV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 18582369 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B3QZS8 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 70
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 434578 | 434766 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 2 | 254754 | 254942 | - | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 3 | 866887 | 867075 | + | NZ_LR215050.1 | Acholeplasma hippikon |
| 4 | 581916 | 582104 | - | NC_022549.1 | Acholeplasma brassicae |
| 5 | 1678092 | 1678283 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 6 | 1259190 | 1259378 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 7 | 1201324 | 1201509 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 8 | 287203 | 287388 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 9 | 2781397 | 2781582 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 10 | 649173 | 649358 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 11 | 2171886 | 2172071 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 12 | 599909 | 600094 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 13 | 1413997 | 1414182 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 14 | 2806838 | 2807023 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 15 | 1555488 | 1555676 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 16 | 2899569 | 2899754 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 17 | 1833955 | 1834143 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 18 | 1562995 | 1563183 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 19 | 1659695 | 1659883 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 20 | 1622135 | 1622323 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 21 | 1628466 | 1628654 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 22 | 330337 | 330525 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 23 | 1655599 | 1655787 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 24 | 1567345 | 1567536 | - | NZ_CP014164.1 | Aerococcus viridans |
| 25 | 1104528 | 1104713 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 26 | 1757692 | 1757877 | + | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 27 | 860977 | 861162 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 28 | 3413703 | 3413876 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 29 | 2125798 | 2125983 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 30 | 1610321 | 1610509 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 31 | 119632 | 119820 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 32 | 806397 | 806582 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 33 | 2350636 | 2350824 | + | NZ_CP011937.1 | Bacillus velezensis |
| 34 | 2356178 | 2356363 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 35 | 2112492 | 2112677 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 36 | 1083112 | 1083297 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 37 | 2944700 | 2944885 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 38 | 1823264 | 1823449 | - | NZ_CP018906.1 | Lentilactobacillus curieae |
| 39 | 656906 | 657091 | - | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 40 | 621320 | 621508 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 41 | 1849132 | 1849320 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 42 | 1864584 | 1864772 | + | NZ_LT906444.1 | Listeria welshimeri |
| 43 | 1944901 | 1945089 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 44 | 1890951 | 1891139 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 45 | 163612 | 163800 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 46 | 1257954 | 1258139 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 47 | 373113 | 373301 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 48 | 865239 | 865427 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 49 | 1087410 | 1087595 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 50 | 1148792 | 1148977 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 51 | 2642304 | 2642492 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 52 | 1025886 | 1026071 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 53 | 2586038 | 2586226 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 54 | 1183420 | 1183608 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 55 | 1033024 | 1033212 | - | NZ_LR134483.1 | Listeria grayi |
| 56 | 1038123 | 1038308 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 57 | 1168202 | 1168393 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 58 | 166392 | 166580 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 59 | 720166 | 720351 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 60 | 2124859 | 2125047 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 61 | 1734156 | 1734344 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 62 | 1463725 | 1463913 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 63 | 1846402 | 1846593 | + | NZ_CP060715.1 | Erysipelothrix inopinata |
| 64 | 994147 | 994338 | - | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 65 | 1726336 | 1726527 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 66 | 554281 | 554433 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 67 | 387312 | 387464 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 68 | 2443570 | 2443758 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 69 | 1917137 | 1917325 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 70 | 1335725 | 1335898 | - | NZ_CP012024.1 | Bacillus smithii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP008876.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03193.18 | 0.91 | 64 | 1596.0 | opposite-strand | RsgA GTPase |
| 2 | PF00834.21 | 0.94 | 66 | 938.5 | opposite-strand | Ribulose-phosphate 3 epimerase family |
| 3 | PF04263.18 | 0.9 | 63 | 202 | opposite-strand | Thiamin pyrophosphokinase, catalytic domain |
| 4 | PF13684.8 | 0.91 | 64 | 631.5 | opposite-strand | Dihydroxyacetone kinase family |
| 5 | PF02734.19 | 0.91 | 64 | 631.5 | opposite-strand | DAK2 domain |
| 6 | PF04265.16 | 0.84 | 59 | 210 | opposite-strand | Thiamin pyrophosphokinase, vitamin B1 binding domain |
| 7 | PF13672.8 | 0.67 | 47 | 4452 | opposite-strand | Protein phosphatase 2C |
| 8 | PF00069.27 | 0.8 | 56 | 2513.0 | opposite-strand | Protein kinase domain |
| 9 | PF07714.19 | 0.8 | 56 | 2513.0 | opposite-strand | Protein tyrosine and serine/threonine kinase |
| 10 | PF03793.21 | 0.8 | 56 | 2513.0 | opposite-strand | PASTA domain |
| 11 | PF16745.7 | 0.8 | 56 | 1605.0 | opposite-strand | RsgA N-terminal domain |
| 12 | PF03780.15 | 0.84 | 59 | 242 | opposite-strand | Asp23 family, cell envelope-related function |
| 13 | PF00271.33 | 0.74 | 52 | 3488.5 | opposite-strand | Helicase conserved C-terminal domain |
| 14 | PF00270.31 | 0.74 | 52 | 3488.5 | opposite-strand | DEAD/DEAH box helicase |
| 15 | PF17191.6 | 0.7 | 49 | 3925 | opposite-strand | RecG wedge domain |
| 16 | PF04851.17 | 0.74 | 52 | 3488.5 | opposite-strand | Type III restriction enzyme, res subunit |
++ More..