Result : EXP02204
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02204 |
| NCBI Accession ID | NC_002947.3 |
| Organism | Pseudomonas putida KT2440 |
| Left | 6147897 |
| Right | 6148076 |
| Strand | - |
| Nucleotide Sequence | CTGTCTGGGGCTGTTGGCCTTAGCGGGTATGTCCGCCAGTTCGGCGCCAATCTGGTCCTGATGGGGGACCTCGGGGCAACAGCGACGTCCGCCATCGCCTGCCAGGATCGTAAGGGACAACTGAAGATGCAGCAGGGTCCGTCGCCAGAGGAGTTGGACGAGATTTTAGGGCGAAGATAA |
| Sequence | LSGAVGLSGYVRQFGANLVLMGDLGATATSAIACQDRKGQLKMQQGPSPEELDEILGRR |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 27717237 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3884258 | 3884425 | + | NZ_CP024159.1 | Pseudomonas mosselii |
| 2 | 1905040 | 1905195 | - | NC_008027.1 | Pseudomonas entomophila L48 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP024159.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11412.10 | 1.0 | 2 | 1429.0 | same-strand | Disulphide bond corrector protein DsbC |
| 2 | PF13899.8 | 1.0 | 2 | 1429.0 | same-strand | Thioredoxin-like |
| 3 | PF02683.17 | 1.0 | 2 | 1429.0 | same-strand | Cytochrome C biogenesis protein transmembrane region |
| 4 | PF13386.8 | 1.0 | 2 | 1429.0 | same-strand | Cytochrome C biogenesis protein transmembrane region |
| 5 | PF13098.8 | 1.0 | 2 | 1014.0 | same-strand | Thioredoxin-like domain |
| 6 | PF08534.12 | 1.0 | 2 | 599.0 | same-strand | Redoxin |
| 7 | PF00578.23 | 1.0 | 2 | 599.0 | same-strand | AhpC/TSA family |
| 8 | PF13905.8 | 1.0 | 2 | 599.0 | same-strand | Thioredoxin-like |
| 9 | PF00668.22 | 1.0 | 2 | 2698.0 | opposite-strand | Condensation domain |
| 10 | PF00501.30 | 1.0 | 2 | 2698.0 | opposite-strand | AMP-binding enzyme |
| 11 | PF00550.27 | 1.0 | 2 | 2698.0 | opposite-strand | Phosphopantetheine attachment site |
| 12 | PF13193.8 | 1.0 | 2 | 2698.0 | opposite-strand | AMP-binding enzyme C-terminal domain |
| 13 | PF08281.14 | 1.0 | 2 | 15964.5 | same-strand | Sigma-70, region 4 |
| 14 | PF04542.16 | 1.0 | 2 | 15964.5 | same-strand | Sigma-70 region 2 |
| 15 | PF04545.18 | 1.0 | 2 | 15964.5 | same-strand | Sigma-70, region 4 |
| 16 | PF00497.22 | 1.0 | 2 | 17139.5 | opposite-strand | Bacterial extracellular solute-binding proteins, family 3 |
++ More..