Result : EXP02203
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02203 |
| NCBI Accession ID | NC_002947.3 |
| Organism | Pseudomonas putida KT2440 |
| Left | 1879092 |
| Right | 1879214 |
| Strand | + |
| Nucleotide Sequence | ATGAACCGCTACCTGATACGCGGCCTGTTGGCTATTGCCGCTCTGTTGCTGCTGGCACTGGTGTGGTGGGGCTGGCATCAGGGTGGGATGGCGCTGATGCAACTGGGCATGAGTGTGTGTTAG |
| Sequence | MNRYLIRGLLAIAALLLLALVWWGWHQGGMALMQLGMSVC |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 27717237 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4655012 | 4655134 | - | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 2 | 1866676 | 1866801 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 3 | 5065280 | 5065378 | - | NZ_CP035088.1 | Pseudomonas viciae |
| 4 | 1925497 | 1925619 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 5 | 1403275 | 1403397 | + | NZ_CP022562.1 | Pseudomonas monteilii |
| 6 | 4789755 | 4789877 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 7 | 5056966 | 5057064 | - | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 8 | 1942445 | 1942543 | - | NZ_CP014262.1 | Pseudomonas corrugata |
| 9 | 4326102 | 4326200 | - | NZ_CP023272.1 | Pseudomonas lurida |
| 10 | 2159666 | 2159788 | - | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 11 | 1911926 | 1912048 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 12 | 3801128 | 3801250 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 13 | 1499446 | 1499568 | + | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 14 | 3432023 | 3432145 | - | NZ_CP009365.1 | Pseudomonas soli |
| 15 | 4361313 | 4361435 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 16 | 5020077 | 5020199 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 17 | 4264033 | 4264155 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 18 | 608755 | 608874 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_021505.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03349.18 | 0.94 | 17 | 840 | opposite-strand | Outer membrane protein transport protein (OMPP1/FadL/TodX) |
| 2 | PF00255.21 | 0.94 | 17 | 55 | same-strand | Glutathione peroxidase |
| 3 | PF07690.18 | 1.0 | 18 | -3.0 | same-strand | Major Facilitator Superfamily |
| 4 | PF12802.9 | 0.94 | 17 | 1263 | same-strand | MarR family |
| 5 | PF13463.8 | 0.89 | 16 | 1262.5 | same-strand | Winged helix DNA-binding domain |
| 6 | PF02654.17 | 0.89 | 16 | 1766.5 | same-strand | Cobalamin-5-phosphate synthase |
| 7 | PF00300.24 | 0.89 | 16 | 2495.5 | same-strand | Histidine phosphatase superfamily (branch 1) |
| 8 | PF02277.19 | 0.83 | 15 | 3062 | same-strand | Phosphoribosyltransferase |
++ More..