Result : EXP02196

Protein Information

• Protein name: EXP02196
• NCBI Accession ID: CP000253.1
• Organism: Staphylococcus aureus subsp. aureus NCTC 8325
• Left: 788217
• Right: 788426
• Strand: +
• Nucleotide Sequence: TTGCTTAATCGGGCTATATTTGATATAGTTATATGTGCTTTTGTAAATTACAAAAGTATGATTTGTTTGATTTATTATTTCGGGGACGTTCATGGATTCGACAGGGGTCCCCCGAGCTCATTAAGCGTGTCGGAGGGTTGTCTTCGTCATCAACACACACAGTTTATAATAACTGGCAAATCAAACAATAATTTCGCAGTAGCTGCCTAA
• Sequence: LLNRAIFDIVICAFVNYKSMICLIYYFGDVHGFDRGPPSSLSVSEGCLRHQHTQFIITGKSNNNFAVAA
• Source of smORF: Ribo-seq
• Pubmed ID: 25313041
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 69

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	788217	788426	+	NC_007795.1	Staphylococcus aureus subsp. aureus NCTC 8325
2	813707	813916	+	NZ_LR134304.1	Staphylococcus schweitzeri

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_007795.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF03840.16	1.0	2	3758.0	same-strand	Preprotein translocase SecG subunit
2	PF12146.10	1.0	2	2902.0	same-strand	Serine aminopeptidase, S33
3	PF00773.21	1.0	2	496.0	same-strand	RNB domain
4	PF17876.3	1.0	2	496.0	same-strand	Cold shock domain
5	PF08206.13	1.0	2	496.0	same-strand	Ribonuclease B OB domain
6	PF00575.25	1.0	2	496.0	same-strand	S1 RNA binding domain
7	PF01668.20	1.0	2	10.0	same-strand	SmpB protein