Result : B3QYE2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | CP001100.1 |
| Organism | Chloroherpeton thalassium (strain ATCC 35110 / GB-78) |
| Left | 1303298 |
| Right | 1303498 |
| Strand | + |
| Nucleotide Sequence | ATGTCTGAGACAAGCAATAAAAAGTTAAAAATCACTCAATATCGTAGTATCATTGGTTGCTCAAAAAAGCAAAAAGCCACAATTAAATGCTTAGGCTTAGGGCGTCCGAATTATTCTCGCGTATTGAATGATAATCCCCTTTTACAAGGGCAATTGAGAGTTGTTCAACATCTTGTCAAAGTTGAGGAAGTTAGCGAGTAA |
| Sequence | MSETSNKKLKITQYRSIIGCSKKQKATIKCLGLGRPNYSRVLNDNPLLQGQLRVVQHLVKVEEVSE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B3QYE2 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 80
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1303298 | 1303498 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 2 | 2448202 | 2448387 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 3 | 2789681 | 2789866 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 4 | 196700 | 196870 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 5 | 2239713 | 2239901 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 6 | 198488 | 198682 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 7 | 296511 | 296696 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 8 | 1028524 | 1028709 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 9 | 2055487 | 2055660 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 10 | 2669728 | 2669901 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 11 | 236019 | 236207 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 12 | 623885 | 624079 | + | NZ_CP066802.1 | Actinomyces weissii |
| 13 | 1614233 | 1614427 | - | NZ_LR134357.1 | Actinomyces israelii |
| 14 | 2795200 | 2795373 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 15 | 383814 | 383999 | - | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 16 | 4866926 | 4867111 | + | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 17 | 1575162 | 1575347 | - | NZ_CP021060.1 | Taylorella equigenitalis |
| 18 | 1544015 | 1544200 | - | NC_016043.1 | Taylorella asinigenitalis MCE3 |
| 19 | 3052485 | 3052664 | + | NZ_CP012040.1 | Cyclobacterium amurskyense |
| 20 | 5770418 | 5770594 | - | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 21 | 375783 | 375968 | - | NC_014246.1 | Mobiluncus curtisii ATCC 43063 |
| 22 | 1104896 | 1105081 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 23 | 3990865 | 3991050 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 24 | 3486266 | 3486454 | - | NC_012669.1 | Beutenbergia cavernae DSM 12333 |
| 25 | 6059558 | 6059734 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 26 | 472154 | 472342 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 27 | 3600058 | 3600240 | + | NC_014759.1 | Marivirga tractuosa DSM 4126 |
| 28 | 1827911 | 1828090 | + | NC_018010.1 | Belliella baltica DSM 15883 |
| 29 | 2065163 | 2065345 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 30 | 2991390 | 2991572 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 31 | 686773 | 686958 | + | NC_007777.1 | Frankia casuarinae |
| 32 | 3729197 | 3729367 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 33 | 1548068 | 1548229 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 34 | 2309398 | 2309577 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 35 | 617658 | 617837 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 36 | 776672 | 776851 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 37 | 318917 | 319102 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 38 | 730042 | 730221 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 39 | 796735 | 796914 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 40 | 2694997 | 2695176 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 41 | 1286618 | 1286797 | + | NZ_CP027770.1 | Staphylococcus felis |
| 42 | 516117 | 516296 | - | NZ_CP055156.1 | Adhaeribacter swui |
| 43 | 2954817 | 2954978 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 44 | 340756 | 340938 | + | NZ_LN879430.1 | Herbinix luporum |
| 45 | 2352197 | 2352385 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 46 | 864379 | 864558 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 47 | 1178378 | 1178566 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 48 | 1169214 | 1169399 | + | NC_008278.1 | Frankia alni ACN14a |
| 49 | 1125651 | 1125851 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 50 | 1098884 | 1099063 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 51 | 250649 | 250828 | - | NC_019904.1 | Echinicola vietnamensis DSM 17526 |
| 52 | 248192 | 248371 | - | NZ_CP040106.1 | Echinicola rosea |
| 53 | 3531008 | 3531187 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 54 | 3041644 | 3041823 | + | NC_015914.1 | Cyclobacterium marinum DSM 745 |
| 55 | 5523691 | 5523870 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 56 | 77387 | 77566 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 57 | 6081776 | 6081946 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 58 | 1256344 | 1256523 | + | NZ_CP012836.1 | Algoriphagus sanaruensis |
| 59 | 392334 | 392513 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 60 | 2126015 | 2126200 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 61 | 3991120 | 3991302 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 62 | 7656380 | 7656562 | - | NC_014666.1 | Frankia inefficax |
| 63 | 1244016 | 1244201 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 64 | 5489451 | 5489636 | - | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 65 | 1195767 | 1195949 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 66 | 2194375 | 2194563 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 67 | 553456 | 553635 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 68 | 1686555 | 1686740 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 69 | 3317516 | 3317701 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 70 | 996951 | 997127 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 71 | 3500336 | 3500497 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 72 | 481339 | 481518 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 73 | 2890540 | 2890722 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 74 | 3433869 | 3434048 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 75 | 3512060 | 3512242 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 76 | 659886 | 660071 | + | NZ_LT906442.1 | Legionella waltersii |
| 77 | 297739 | 297921 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 78 | 5609639 | 5609821 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 79 | 1215389 | 1215574 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 80 | 526885 | 527061 | + | NC_006526.2 | Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010803.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 0.94 | 75 | 1986 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00410.21 | 1.0 | 80 | 1544.5 | same-strand | Ribosomal protein S8 |
| 3 | PF00347.25 | 1.0 | 80 | 966.5 | same-strand | Ribosomal protein L6 |
| 4 | PF00861.24 | 1.0 | 80 | 551.0 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 5 | PF03719.17 | 1.0 | 80 | 8.0 | same-strand | Ribosomal protein S5, C-terminal domain |
| 6 | PF00333.22 | 1.0 | 80 | 8.0 | same-strand | Ribosomal protein S5, N-terminal domain |
| 7 | PF00828.21 | 0.99 | 79 | 15 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 8 | PF00344.22 | 0.9 | 72 | 475.0 | same-strand | SecY |
| 9 | PF00557.26 | 0.61 | 49 | 2423 | same-strand | Metallopeptidase family M24 |
++ More..