Result : EXP02171
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02171 |
| NCBI Accession ID | CP000253.1 |
| Organism | Staphylococcus aureus subsp. aureus NCTC 8325 |
| Left | 1418908 |
| Right | 1419024 |
| Strand | - |
| Nucleotide Sequence | ATGCTCACACAGTCTGAGATGATTGTAGTGTTCGTGCTTGATGAAACAATAAATCAAGGCATTAATTTGACGGCAATGAAATATCCTAAGTCTTTCGATATGGATAGAGTAATTTGA |
| Sequence | MLTQSEMIVVFVLDETINQGINLTAMKYPKSFDMDRVI |
| Source of smORF | Ribo-seq |
| Function | Translational arrest peptide which serves as a cis regulator of downstream gene expression. Pubmed:25313041 |
| Pubmed ID | 25313041 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1418908 | 1419024 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1522837 | 1522947 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2126901 | 2127020 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 4 | 1402475 | 1402594 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 5 | 397006 | 397122 | + | NC_012924.1 | Streptococcus suis SC84 |
| 6 | 2759893 | 2759991 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 7 | 3105153 | 3105254 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 8 | 1243028 | 1243150 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 9 | 1294255 | 1294374 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 10 | 444038 | 444166 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 11 | 4725536 | 4725664 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 12 | 3276060 | 3276155 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 13 | 615369 | 615485 | + | NZ_LR594049.1 | Streptococcus gordonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01170.20 | 0.92 | 12 | 373.0 | same-strand | Putative RNA methylase family UPF0020 |
| 2 | PF02926.19 | 0.69 | 9 | 382 | same-strand | THUMP domain |
| 3 | PF06908.13 | 0.62 | 8 | 526.5 | same-strand | YspA SLOG family |
++ More..