Result : EXP02169
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02169 |
| NCBI Accession ID | CP000253.1 |
| Organism | Staphylococcus aureus subsp. aureus NCTC 8325 |
| Left | 1639061 |
| Right | 1639219 |
| Strand | - |
| Nucleotide Sequence | TTGTTCGTAAGTTTGCTTTTTAATTTGGGCCTAACACTCTTTGATCAAGGGAGCCCAATGGGTTTTCTTGCAGCGTACACGCCTTATATGAAGGACGTACAAAACAAGAAACAGGGCACCCACCTGTATATAACAGGCCGAATGATCAAGCTATTATAA |
| Sequence | LFVSLLFNLGLTLFDQGSPMGFLAAYTPYMKDVQNKKQGTHLYITGRMIKLL |
| Source of smORF | Ribo-seq |
| Function | Translational arrest peptide which serves as a cis regulator of downstream gene expression. Pubmed:25313041 |
| Pubmed ID | 25313041 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1639061 | 1639219 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1703559 | 1703717 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05532.14 | 1.0 | 2 | 3031.5 | same-strand | CsbD-like |
| 2 | PF12002.10 | 1.0 | 2 | 1149.0 | opposite-strand | MgsA AAA+ ATPase C terminal |
| 3 | PF16193.7 | 1.0 | 2 | 1149.0 | opposite-strand | AAA C-terminal domain |
| 4 | PF00004.31 | 1.0 | 2 | 1149.0 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
| 5 | PF13173.8 | 1.0 | 2 | 1149.0 | opposite-strand | AAA domain |
| 6 | PF00152.22 | 1.0 | 2 | 89.0 | same-strand | tRNA synthetases class II (D, K and N) |
| 7 | PF02938.16 | 1.0 | 2 | 89.0 | same-strand | GAD domain |
| 8 | PF01336.27 | 1.0 | 2 | 89.0 | same-strand | OB-fold nucleic acid binding domain |
| 9 | PF13393.8 | 1.0 | 2 | 1871.0 | same-strand | Histidyl-tRNA synthetase |
| 10 | PF00587.27 | 1.0 | 2 | 1871.0 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 11 | PF03129.22 | 1.0 | 2 | 1871.0 | same-strand | Anticodon binding domain |
| 12 | PF01520.20 | 1.0 | 2 | 3590.5 | same-strand | N-acetylmuramoyl-L-alanine amidase |
| 13 | PF08239.13 | 1.0 | 2 | 3590.5 | same-strand | Bacterial SH3 domain |
| 14 | PF02580.18 | 1.0 | 2 | 4462.5 | same-strand | D-Tyr-tRNA(Tyr) deacylase |
| 15 | PF13328.8 | 1.0 | 2 | 4926.5 | same-strand | HD domain |
| 16 | PF04607.19 | 1.0 | 2 | 4926.5 | same-strand | Region found in RelA / SpoT proteins |
| 17 | PF02824.23 | 1.0 | 2 | 4926.5 | same-strand | TGS domain |
| 18 | PF13291.8 | 1.0 | 2 | 4926.5 | same-strand | ACT domain |
| 19 | PF01966.24 | 1.0 | 2 | 4926.5 | same-strand | HD domain |
| 20 | PF19296.1 | 1.0 | 2 | 4926.5 | same-strand | Domain of unknown function (DUF5913) |
| 21 | PF01842.27 | 1.0 | 2 | 4926.5 | same-strand | ACT domain |
++ More..