Result : EXP02168

Protein Information

• Protein name: EXP02168
• NCBI Accession ID: CP000253.1
• Organism: Staphylococcus aureus subsp. aureus NCTC 8325
• Left: 812916
• Right: 813098
• Strand: +
• Nucleotide Sequence: ATGATGCGTAAACTCTTATCGAGAGTGGTGGAGGGATGTGCCCTACGAAGCCCGGCAACCGTCTTATATAGAAATGGTGCCAATTCACATAAAGTTTTAACTTTTGAAGATGAGAGAAACAATACTACTATTGCTTTCTCAATTTTTCTATCGATATTGAGAAAGCATTTTTTATTTTATTAA
• Sequence: MMRKLLSRVVEGCALRSPATVLYRNGANSHKVLTFEDERNNTTIAFSIFLSILRKHFLFY
• Source of smORF: Ribo-seq
• Function: Translational arrest peptide which serves as a cis regulator of downstream gene expression. Pubmed:25313041
• Pubmed ID: 25313041
• Functional Category: Manually curated function from literature
• ORF Length (Amino Acid): 60

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	812916	813098	+	NC_007795.1	Staphylococcus aureus subsp. aureus NCTC 8325
2	881997	882155	+	NZ_LR134304.1	Staphylococcus schweitzeri

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_007795.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01597.21	1.0	2	2280.0	same-strand	Glycine cleavage H-protein
2	PF00085.22	1.0	2	46.0	same-strand	Thioredoxin
3	PF00005.29	1.0	2	34.0	same-strand	ABC transporter
4	PF09383.12	1.0	2	34.0	same-strand	NIL domain
5	PF13401.8	1.0	2	34.0	same-strand	AAA domain
6	PF00528.24	1.0	2	1052.0	same-strand	Binding-protein-dependent transport system inner membrane component
7	PF03180.16	1.0	2	1765.0	same-strand	NlpA lipoprotein
8	PF05532.14	1.0	2	2897.0	same-strand	CsbD-like
9	PF04018.15	1.0	2	3329.0	opposite-strand	Domain of unknown function (DUF368)